Recombinant Uncharacterized protein Rv0007/MT0007 (Rv0007, MT0007)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Target Names
Rv0007, MT0007
Target Protein Sequence
MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPPWQRAATRQSQAGHRQ PPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQPDPDASLGCGDGSPAE AYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSGGRSITAESRDARVQLSA RRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAFLYLVLGGMGVWAKLNSNV GDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATIGAFVYNLITDLIGGIEVTL ADRD
Uniprot No.

Q&A

What is Rv0007/MT0007 and what are its basic characteristics?

Rv0007/MT0007 is a possible conserved membrane protein in Mycobacterium tuberculosis H37Rv with the following characteristics:

  • Protein length: 304 amino acids

  • Gene location: CDS 9914-10828 on the positive strand

  • Gene length: 915 base pairs

  • Classified as a core mycobacterial gene conserved across mycobacterial strains

The protein is currently designated as "uncharacterized" or "hypothetical" because while its existence is predicted from genomic data, its precise biological function remains undetermined. Bioinformatic analysis suggests it may function as a membrane protein, but experimental validation is still needed.

What functional predictions exist for Rv0007 based on computational analyses?

Computational analyses suggest several potential functions and characteristics for Rv0007:

  • Predicted to be co-regulated in modules bicluster_0154 (residual 0.56) and bicluster_0161 (residual 0.58)

  • Regulation potentially mediated by two de-novo identified cis-regulatory motifs in each module

  • These modules are enriched for specific GO terms related to nitrate reductase complex, nitrate reductase activity, and oxidoreductase activity

  • Functionally linked to growth on cholesterol, suggesting potential involvement in lipid metabolism pathways

Protein interaction network analysis from STRING database indicates high confidence interactions (score > 0.7) with multiple partners:

Protein PartnerFunctionInteraction Score
gyrADNA gyrase subunit A0.946
Rv1565cConserved hypothetical membrane protein0.811
gyrBDNA gyrase subunit B0.772
Rv1024Possible conserved membrane protein0.771
Rv3909Conserved protein0.743

The high-confidence interaction with DNA gyrase subunits (gyrA and gyrB) suggests potential involvement in DNA topology regulation processes .

How can researchers determine if Rv0007 is essential for Mycobacterium tuberculosis survival?

To determine essentiality of Rv0007, researchers can employ several methodological approaches:

  • Transposon Mutagenesis Screening:

    • Utilize high-density transposon libraries to disrupt the Rv0007 gene

    • Calculate fitness scores by comparing the proportion of transposon reads mapped to the gene after growth under different conditions

    • Scores below 1.0 indicate reduced fitness relative to the population

  • CRISPR-Cas9 Gene Editing:

    • Apply CRISPR-Cas9 system for targeted gene knockout

    • Assess viability of bacterial cultures following gene disruption

    • Use CRISPRCasFinder to identify CRISPR-Cas9 related genes in the genomic context

  • Conditional Gene Expression Systems:

    • Implement inducible promoters to control Rv0007 expression

    • Monitor growth rates under repressed versus induced conditions

    • Compare growth in different media conditions to identify context-dependent essentiality

  • Comparative Genomics:

    • Analyze conservation across mycobacterial species

    • Core conserved genes often indicate essential functions

    • Examine distribution in clinical isolates versus laboratory strains

What are the most effective strategies for recombinant expression and purification of Rv0007?

For recombinant expression and purification of Rv0007, researchers should consider:

Expression System Selection:

  • Mammalian Cell Expression: HEK293 cells provide proper folding and post-translational modifications for membrane proteins

  • E. coli Expression: BL21(DE3) strains with specialized vectors for membrane proteins (e.g., pET derivatives with mild induction conditions)

  • Mycobacterial Expression: M. smegmatis expression systems for homologous expression environment

Tag Selection and Optimization:

  • C-terminal His-tag (6-10×His) for IMAC purification

  • Consider TEV protease cleavage sites for tag removal

  • Alternative tags (e.g., Strep-tag II, FLAG) if His-tag affects function

Purification Protocol:

  • Membrane fraction isolation with differential centrifugation

  • Solubilization using mild detergents (e.g., DDM, LDAO, or MNG derivatives)

  • IMAC purification with imidazole gradient elution

  • Size exclusion chromatography for final polishing

Quality Control Parameters:

  • Purity assessment by SDS-PAGE (>95%)

  • Western blot confirmation

  • Mass spectrometry verification

  • Endotoxin testing (<1 EU/μg)

How can global phenotypic profiling be applied to elucidate Rv0007 function?

Global phenotypic profiling represents a powerful approach to understand Rv0007 function through systematic analysis of mutant phenotypes across various conditions:

Methodology Framework:

  • Generate a high-density transposon library in M. tuberculosis

  • Culture the library under diverse stress conditions (antimicrobials, nutrient limitation, host-mimicking environments)

  • Isolate genomic DNA and analyze transposon insertion profiles through sequencing

  • Calculate fitness scores by comparing read proportions between treatment and control conditions

Experimental Design Considerations:

  • Include conditions targeting membrane integrity, cell wall synthesis, and DNA replication (based on predicted interactions with gyrA/gyrB)

  • Create an Rv0007 knockout strain for targeted phenotypic comparison

  • Employ at least two biological replicates per condition to ensure reproducibility

Data Analysis Approach:

  • Identify conditions where Rv0007 mutants show significant fitness defects (scores < 0.9)

  • Look for correlation patterns between Rv0007 and known functional genes

  • Apply hierarchical clustering to identify genes with similar profiles

In a representative study using this approach with Corynebacterium glutamicum (a related actinobacterium), researchers identified clusters of genes with highly correlated phenotypic profiles, including cytochrome bd oxidase (cydA and cydB) and cytochrome transporter (cydC and cydD) genes that clustered together due to hypersensitivity to specific compounds .

What approaches should be used when functional data for Rv0007 yields contradictory results?

When faced with contradictory functional data for Rv0007, researchers should implement a structured approach to resolve inconsistencies:

Systematic Contradiction Analysis:

  • Apply the (α, β, θ) notation system where:

    • α represents the number of interdependent items

    • β represents the number of contradictory dependencies identified

    • θ represents the minimal number of Boolean rules required to assess these contradictions

  • Evaluate experimental design factors:

    • Analyze if randomization produced equivalent groups in comparative studies

    • Consider implementing a Solomon four-group design to address concerns about pretesting effects and randomization failures

    • Examine if study design was properly separated from statistical design in methodology reporting

Data Resolution Strategies:

  • Examine Data Thoroughly:

    • Identify outliers that may influence results

    • Compare findings with existing literature to identify discrepancies

  • Evaluate Assumptions:

    • Review initial hypotheses and research design

    • Consider alternative mechanisms or functions

  • Modify Data Collection:

    • Refine variables and implement additional controls

    • Perform targeted experiments to test specific contradictions

Implementation Example:
For contradictory localization data on Rv0007, implement subcellular fractionation coupled with fluorescent protein fusion studies, followed by co-localization experiments with known interaction partners (gyrA/gyrB) to determine if the protein shows differential localization under varying conditions .

How can functional analysis methodology be applied to characterize Rv0007's role in M. tuberculosis?

Functional analysis methodology offers a structured framework for elucidating Rv0007's biological role through systematic manipulation of environmental variables:

Core Methodological Components:

  • Direct observation and measurement of phenotypes associated with Rv0007 mutation/overexpression

  • Manipulation of at least two environmental conditions to demonstrate relationships between environmental variables and protein function

  • Implementation of appropriate experimental designs (multielement, reversal, or pairwise test-control)

Practical Implementation Strategy:

  • Initial Case Selection:

    • Begin with conditions strongly suspected to involve Rv0007 based on bioinformatic predictions

    • Positive test results for predicted functions provide face validity for the methodology

  • Condition Design and Testing:

    • Test-control design with selective pressures targeting membrane function

    • Single-function testing focused on DNA topology (based on gyrA/gyrB interactions)

    • Brief functional analysis (BFA) for rapid screening across multiple conditions

  • Data Analysis and Interpretation:

    • Establish believable demonstration of events responsible for phenotype changes

    • Apply graphical analysis methods similar to Figure 1 patterns in functional analysis literature

Addressing Practical Constraints:

  • Time limitations: Employ brief functional analysis (BFA) with condensed sessions

  • Risk management: Use targeted gene expression modulation rather than complete knockout

  • Environmental control challenges: Implement pairwise test-control design to reduce confounding variables

What yeast two-hybrid screening approaches are most effective for identifying host proteins that interact with Rv0007?

Yeast two-hybrid (Y2H) screening offers a powerful method to identify interaction partners for uncharacterized proteins like Rv0007. Based on successful applications with other mycobacterial proteins, the following approach is recommended:

Optimized Y2H Protocol:

  • Bait Construction:

    • Clone Rv0007 gene into pGBKT7 vector to create pGBKT7-Rv0007 bait plasmid

    • Verify proper expression of the GAL4 DNA-binding domain fusion protein

    • Test for auto-activation and toxicity in yeast cells

  • Library Screening:

    • Use a high-quality cDNA library from relevant host tissues (e.g., human macrophage or lung tissue)

    • Transform bait and prey plasmids into compatible yeast strains

    • Perform mating to generate diploid cells containing both plasmids

    • Plate on selective media (SD/-Ade/-His/-Leu/-Trp) to identify positive interactions

  • Positive Clone Verification:

    • Isolate plasmids from positive colonies and sequence inserts

    • Perform BLAST search against NCBI database to identify interacting proteins

    • Reconfirm interactions through retransformation and growth on selective media

Validation and Follow-up:

  • Verify identified interactions via co-immunoprecipitation

  • Assess subcellular co-localization of Rv0007 with identified partners

  • Conduct GST pull-down assays with recombinant proteins

  • Evaluate expression changes of interaction partners during M. tuberculosis infection

Based on similar studies with mycobacterial proteins, expect to identify 15-25 potential interacting proteins after initial screening, which will be reduced to 5-10 high-confidence interactions after validation steps .

How can researchers address the stability challenges in expressing recombinant Rv0007 for functional studies?

Membrane protein expression and stability represent significant challenges for recombinant protein production. For Rv0007, researchers should implement these specialized approaches:

Expression System Optimization:

  • Bacmid-Based Expression Systems:

    • Relocate the attTn7 transgene insertion site away from the mini-F replicon to prevent deletion of the gene of interest

    • This approach has been shown to result in higher and more prolonged recombinant protein expression levels

  • Specialized Expression Vectors:

    • Employ vectors with lambda red genome engineering combined with SacB counterselection

    • Test expression from the odv-e56 (pif-5) locus, which has shown improved stability over serial passages

Stability Enhancement Strategies:

  • Fusion Partners and Solubility Tags:

    • Incorporate carrier proteins to improve stability and prevent adhesion to container walls

    • Use maltose-binding protein (MBP) or SUMO tags to enhance solubility while maintaining function

  • Buffer and Additive Optimization:

    • Include appropriate detergents for membrane protein stabilization (DDM, LDAO)

    • Test stabilizing additives such as glycerol (10-20%), specific lipids, or cholesterol

    • Optimize pH and salt conditions based on theoretical isoelectric point

  • Storage Condition Development:

    • Lyophilize from solutions filtered through 0.22 μm filters containing PBS

    • Implement flash-freezing protocols to minimize freeze-thaw damage

    • Evaluate cryo-protectants for long-term storage

Quality Control Metrics:

  • Protein purity >95% as determined by Tris-Bis PAGE and HPLC

  • Endotoxin levels <1 EU/μg by the LAL method

  • Functional activity assessment through specific binding assays

  • Structural integrity verification via circular dichroism spectroscopy

How can contradictory phenotypic data for Rv0007 mutants be systematically analyzed?

When confronted with contradictory phenotypic data from Rv0007 mutant studies, researchers should employ a structured analytical framework:

Systematic Contradiction Resolution Process:

  • Formalized Contradiction Pattern Analysis:

    • Apply the (α, β, θ) notation system to classify contradiction patterns:

      • α: number of interdependent phenotypic variables

      • β: number of contradictory dependencies observed

      • θ: minimal Boolean rules required to assess contradictions

    • Most basic contradiction checks implement the (2,1,1) class, but complex phenotypes require more sophisticated approaches

  • Experimental Design Reassessment:

    • Evaluate if study design properly separates data acquisition from statistical analysis

    • Consider if randomization was effective in creating equivalent experimental groups

    • Implement Solomon four-group design to address pretest effects and randomization challenges

  • Structured Data Examination Protocol:

    • Identify outliers using standardized statistical methods

    • Compare findings with existing literature on similar membrane proteins

    • Examine environmental variables that might influence phenotype expression

Practical Implementation Example:
For contradictory growth phenotypes of Rv0007 mutants under different stress conditions, create a multidimensional analysis that:

  • Maps all test conditions on intersecting axes

  • Identifies the minimum set of Boolean rules that explain observed contradictions

  • Tests predictions with targeted follow-up experiments focusing on specific condition combinations

This approach has successfully resolved complex contradictions in biobank and COVID-19 data domains, demonstrating that the minimum number of Boolean rules (θ) might be significantly lower than the number of contradictions described by domain experts (β) .

What can functional correlations between Rv0007 and other mycobacterial genes reveal about its biological role?

Functional correlation analysis provides critical insights into the biological context and potential roles of uncharacterized proteins like Rv0007:

Correlation Analysis Methodologies:

  • Global Phenotypic Profiling Correlation:

    • Calculate fitness score correlations across multiple stress conditions

    • Cluster genes with similar phenotypic profiles

    • Identify functional networks through correlation pattern analysis

    In Corynebacterium glutamicum studies, this approach successfully grouped genes with related functions, such as cytochrome bd oxidase (cydA/cydB) and transporter (cydC/cydD) genes clustering due to similar hypersensitivity profiles .

  • Co-expression Network Analysis:

    • Examine transcriptional co-regulation patterns

    • Identify modules containing Rv0007 and functionally annotated genes

    • Analyze enriched GO terms within co-expression modules

    Rv0007 is predicted to be co-regulated in modules enriched for nitrate reductase complex function and oxidoreductase activity, suggesting potential involvement in these metabolic processes .

  • Protein-Protein Interaction Network:

    • Map high-confidence interaction partners from STRING database

    • Perform pathway enrichment analysis of the interaction network

    • Identify cellular processes overrepresented in the network

Biological Role Inference:
Based on correlations with DNA gyrase subunits (gyrA/gyrB) and multiple conserved membrane proteins, Rv0007 likely functions in one or more of these contexts:

  • DNA topology regulation near the cell membrane

  • Cell division and chromosome segregation processes

  • Membrane integrity maintenance during stress conditions

  • Drug efflux or resistance mechanisms involving membrane transport

How can researchers distinguish between direct and indirect effects when analyzing Rv0007 knockout phenotypes?

Distinguishing direct from indirect effects in Rv0007 knockout phenotypes requires a multi-faceted analytical approach:

Methodological Framework:

  • Genetic Complementation Studies:

    • Create precise gene deletions using specialized techniques

    • Complement with wild-type Rv0007 under native or inducible promoters

    • Test if complementation fully restores wild-type phenotypes

    • Perform site-directed mutagenesis to identify critical residues

  • Conditional Expression Systems:

    • Implement regulated promoters (e.g., tetracycline-inducible) to control Rv0007 expression

    • Monitor temporal relationship between protein depletion and phenotype onset

    • Direct effects typically appear rapidly after protein depletion

    • Indirect effects emerge gradually as downstream processes are affected

  • Functional Analysis Methodology:

    • Apply pairwise test-control design to isolate specific functional relationships

    • Use single-function testing focused on predicted processes

    • Establish "believable demonstration" of events responsible for phenotype changes

Advanced Analytical Approaches:

  • Time-course Analysis:

    • Monitor phenotypic changes at multiple time points after Rv0007 depletion

    • Plot temporal emergence of different phenotypes

    • Direct effects typically precede indirect consequences

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map changes to metabolic and regulatory networks

    • Identify primary nodes (direct effects) versus secondary perturbations

    • Apply pathway enrichment analysis to distinguish immediate targets

  • Suppressor Screening:

    • Identify genetic suppressors that rescue Rv0007 knockout phenotypes

    • Suppressors of direct effects typically function in the same pathway

    • Suppressors of indirect effects often function in compensatory pathways

This comprehensive approach enables researchers to construct causal relationship maps that separate primary functions of Rv0007 from secondary consequences of its absence, providing a clearer understanding of its biological roles.

How can functional analysis of Rv0007 contribute to tuberculosis drug development?

The functional characterization of Rv0007 has significant implications for tuberculosis drug development through several research pathways:

Drug Development Applications:

  • Target Validation Pathway:

    • Establish essentiality through transposon mutagenesis screening

    • Calculate fitness scores across different growth conditions

    • Validate conservation across clinical M. tuberculosis isolates

    • Assess absence of human homologs to minimize off-target effects

  • Structure-Function Analysis for Drug Design:

    • Determine membrane topology and critical functional domains

    • Identify binding sites for potential small molecule inhibitors

    • Perform in silico docking studies to identify lead compounds

    • Test structure-activity relationships of promising inhibitors

  • Resistance Mechanism Studies:

    • Investigate Rv0007's relationship with known drug targets (e.g., DNA gyrase)

    • Assess potential role in intrinsic or acquired drug resistance

    • Evaluate synergistic drug combinations targeting Rv0007 and interacting proteins

Research Application Example:
The high-confidence interaction between Rv0007 and DNA gyrase subunits (gyrA/gyrB) suggests potential involvement in fluoroquinolone resistance mechanisms. This relationship could be exploited to develop combination therapies that target both gyrase and Rv0007, potentially overcoming resistance mechanisms or enhancing drug efficacy through synergistic effects .

Similar approaches with other bacterial systems have successfully identified novel drug targets and resistance mechanisms, such as the finding that cytochrome bd oxidase (cydA/cydB) cluster with sensitivity to benzothiazinone BTZ043, leading to the discovery of synergistic effects between electron transport chain inhibitors and benzothiazinones against M. tuberculosis .

What host-pathogen interaction studies should be conducted to understand Rv0007's role in tuberculosis pathogenesis?

To elucidate Rv0007's role in host-pathogen interactions and tuberculosis pathogenesis, researchers should implement a comprehensive experimental program:

Host-Pathogen Interaction Research Framework:

  • Yeast Two-Hybrid Screening for Host Interactions:

    • Clone Rv0007 gene into pGBKT7 vector as bait

    • Screen against human macrophage or lung tissue cDNA libraries

    • Identify and validate host protein interactions through secondary assays

    • Conduct BLAST analysis and GO enrichment of identified partners

  • Infection Model Studies:

    • Compare wild-type and Rv0007-deficient M. tuberculosis in:

      • Macrophage infection assays (survival, replication, cytokine induction)

      • Human cell line models (A549, THP-1)

      • Animal infection models (mice, guinea pigs)

    • Assess bacterial burden, granuloma formation, and immune responses

  • Host Response Analysis:

    • Measure expression changes of host factors during infection

    • Conduct RT-qPCR to assess regulation of key immune genes

    • Evaluate whether Rv0007 induces specific host pathways

    • Compare cytokine/chemokine profiles induced by wild-type versus mutant strains

Methodological Approach Example:
Based on successful studies with other mycobacterial proteins like ARV p17, researchers should implement co-immunoprecipitation and GST pulldown assays to confirm direct interactions between Rv0007 and identified host factors. Subcellular localization studies using fluorescent protein fusions can verify colocalization, while RT-qPCR can assess expression changes during infection .

In a representative study of ARV p17 protein-host interactions, researchers identified 19 interacting proteins after several rounds of screening. Gene ontology enrichment analysis revealed involvement in multicellular organismal processes, metabolic processes, and biological regulation. Follow-up validation confirmed direct interaction with specific host factors (IGF2BP1 and PQBP1) that significantly impacted viral replication .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.