Recombinant Uncharacterized protein Rv0008c/MT0010 (Rv0008c, MT0010)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Target Names
Rv0008c, MT0010
Target Protein Sequence
MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSARSTAAGLRRRYREGR LAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLWIFAGIAAAILAGGAVA FSIVRRSSRPEPSPRPPSVEVQPRS
Uniprot No.

Q&A

What is Recombinant Uncharacterized protein Rv0008c/MT0010?

Recombinant Uncharacterized protein Rv0008c/MT0010 is a protein encoded by the Rv0008c gene in Mycobacterium tuberculosis. As suggested by its name, the protein's specific function remains largely uncharacterized in the scientific literature. Similar to other Mycobacterium tuberculosis proteins, it is likely produced through recombinant expression systems such as baculovirus for research purposes. The protein is part of the broader effort to understand the complete proteome of Mycobacterium tuberculosis and may play roles in bacterial survival, virulence, or metabolic processes that have yet to be fully elucidated through functional studies.

What are the recommended storage conditions for Recombinant Uncharacterized protein Rv0008c/MT0010?

The optimal storage conditions for Recombinant Uncharacterized protein Rv0008c/MT0010 are similar to those for other recombinant proteins from Mycobacterium tuberculosis. Based on standard practices for similar proteins, the shelf life depends on several factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. For liquid formulations, storage at -20°C/-80°C typically provides shelf stability for approximately 6 months, while lyophilized preparations generally remain stable for up to 12 months at the same temperatures . Repeated freeze-thaw cycles should be avoided to maintain protein integrity. Working aliquots can be stored at 4°C for up to one week .

How should I reconstitute lyophilized Recombinant Uncharacterized protein Rv0008c/MT0010?

For optimal reconstitution of lyophilized Recombinant Uncharacterized protein Rv0008c/MT0010:

  • Briefly centrifuge the vial before opening to ensure all content is at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (commonly 50%) to improve stability

  • Aliquot the reconstituted protein into smaller volumes to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

This reconstitution protocol helps maintain protein activity and structural integrity for downstream experimental applications.

What experimental designs are most appropriate for functional characterization of Recombinant Uncharacterized protein Rv0008c/MT0010?

When designing experiments to characterize the function of Recombinant Uncharacterized protein Rv0008c/MT0010, researchers should consider three primary experimental design approaches:

  • Independent Samples Design: This approach involves dividing your sample into different experimental groups, with each group experiencing only one condition. For example, when testing protein-protein interactions or enzymatic activity, you might have one group with the Rv0008c protein and another with a control protein . This design effectively controls for order effects but requires larger sample sizes.

  • Repeated Measures Design: In this design, all samples are exposed to all experimental conditions, but at different times. For instance, when studying the binding kinetics of Rv0008c/MT0010 with potential substrates, the same protein preparation could be tested with different substrates sequentially . This approach reduces sample variability but may introduce order effects.

  • Matched Pairs Design: Similar to independent samples but with samples paired based on specific criteria before being separated into different groups. For protein characterization, this might involve preparing matched protein samples (e.g., wild-type and mutant versions of Rv0008c) under identical conditions before subjecting them to different treatments .

The choice between these designs depends on your specific research question, available resources, and the nature of the experiments being conducted.

How can I address contradictory data when analyzing Rv0008c/MT0010 sequencing results?

When encountering contradictory sequencing data for Rv0008c/MT0010, implement this systematic approach:

  • Verify original H37Rv reference sequence: Several genes in the Mycobacterium tuberculosis genome have been found to contain errors in the original H37Rv sequence. Check if Rv0008c has documented corrections in recent literature .

  • Compare with multiple genome sequences: Cross-reference your sequencing results with multiple published genome sequences of different M. tuberculosis strains. Polymorphisms might represent genuine strain differences rather than errors .

  • Consider silent mutations: Many documented variations in M. tuberculosis genes are synonymous substitutions (e.g., gcT/gcC resulting in no amino acid change). These can be strain-specific markers rather than functional mutations .

  • Implement statistical analysis: When analyzing sequence data from multiple sources:

Analysis ApproachApplicationOutput Interpretation
Multiple Sequence AlignmentCompare against 3+ reference genomesIdentify conserved vs. variable regions
SNP AnalysisIdentify single nucleotide polymorphismsDetermine if variations match known strain markers
Phylogenetic AnalysisPlace your sequence in evolutionary contextCheck if variations align with specific lineages
Error Probability CalculationAssess technical error likelihoodDistinguish between sequencing errors and true variants
  • Validate with different methods: Confirm important findings using alternative sequencing methods or PCR-based approaches to rule out methodology-specific artifacts .

What qualitative methodologies are appropriate for characterizing protein-protein interactions involving Rv0008c/MT0010?

For characterizing protein-protein interactions involving Rv0008c/MT0010, these qualitative methodological approaches are recommended:

  • Co-immunoprecipitation (Co-IP): This technique allows for the isolation of protein complexes from cell lysates using specific antibodies. While primarily qualitative, it provides valuable insights into whether Rv0008c/MT0010 interacts with suspected binding partners in a cellular context. The results should be analyzed through descriptive approaches focusing on the presence or absence of interaction rather than quantitative measurements .

  • Yeast Two-Hybrid (Y2H) Assays: This system enables detection of direct physical interactions between Rv0008c/MT0010 and other proteins in a cellular environment. The methodology involves creating fusion constructs and observing reporter gene activation when interaction occurs. Analysis should focus on describing the interaction patterns observed rather than quantitative strength measurements .

  • Proximity Ligation Assay (PLA): This technique visualizes protein interactions in situ using antibody-conjugated oligonucleotides. For uncharacterized proteins like Rv0008c/MT0010, PLA provides contextual information about where interactions occur within cellular structures. The analysis focuses on observation and description of interaction patterns within the biological sample .

These qualitative approaches are particularly valuable in early characterization stages of uncharacterized proteins, as they help establish the existence of interactions before quantitative assessment of interaction strength or kinetics is undertaken.

What quantitative methodologies should be employed to measure binding affinity of Rv0008c/MT0010 to potential substrates?

For quantitative determination of binding affinities between Rv0008c/MT0010 and potential substrates, these methodologies are recommended:

  • Surface Plasmon Resonance (SPR): This label-free technique allows real-time measurement of binding kinetics and thermodynamics. The Rv0008c/MT0010 protein should be immobilized on a sensor chip, and potential substrates flowed over the surface. Analysis involves fitting association and dissociation curves to mathematical models to derive equilibrium dissociation constants (KD values) .

  • Isothermal Titration Calorimetry (ITC): This technique measures heat changes during binding events and provides complete thermodynamic profiles. The experimental setup should involve titrating the substrate into a solution containing Rv0008c/MT0010, with careful control of buffer conditions to minimize non-specific heat effects. Analysis yields binding constants, stoichiometry, and enthalpy/entropy contributions to binding .

  • Microscale Thermophoresis (MST): This technique measures changes in fluorescent molecules' movement in temperature gradients upon binding. For Rv0008c/MT0010 studies, the protein should be fluorescently labeled while maintaining its native structure. Titration with increasing concentrations of unlabeled substrate allows determination of KD values through dose-response curve analysis .

The following data analysis parameters should be considered for these quantitative methodologies:

MethodologyKey ParametersAnalysis ApproachTypical Detection Range
SPRka, kd, KDLangmuir binding modelKD: 10⁻³ to 10⁻¹² M
ITCΔH, ΔS, ΔG, KD, nOne-site binding modelKD: 10⁻³ to 10⁻⁹ M
MSTKDHill equationKD: 10⁻³ to 10⁻¹² M

How should researchers analyze SNP data when studying Rv0008c/MT0010 gene variations across Mycobacterium tuberculosis strains?

When analyzing single nucleotide polymorphisms (SNPs) in the Rv0008c/MT0010 gene across different M. tuberculosis strains, researchers should implement a systematic analytical approach:

  • Reference selection: Use the corrected H37Rv genome as your primary reference, as original sequences may contain errors. For Mycobacterium tuberculosis genes, several corrections have been documented where the original H37Rv sequence contained errors .

  • SNP identification and classification: Categorize identified SNPs as synonymous (not changing amino acid) or non-synonymous (changing amino acid). Many documented variations in M. tuberculosis genes are synonymous substitutions which can serve as strain markers while not affecting protein function .

  • Lineage association analysis: Determine if specific SNPs correlate with known M. tuberculosis lineages. For example, certain nucleotide variations serve as specific markers for lineage II strains of M. tuberculosis .

  • Statistical validation: Apply statistical tests to determine the significance of observed variations:

Statistical TestApplicationInterpretation
Chi-square testAssociation of SNPs with phenotypic traitsp < 0.05 indicates significant association
FST analysisPopulation differentiation based on SNPsValues > 0.15 suggest significant population structure
Tajima's D testSelection pressure on gene regionsNegative values suggest purifying selection
Linkage disequilibrium analysisCo-inheritance of SNPsr² > 0.8 indicates strong linkage
  • Functional prediction: For non-synonymous SNPs, employ bioinformatic tools to predict potential functional impacts on the protein structure and function .

This methodological approach ensures robust identification and interpretation of genetic variations in Rv0008c/MT0010 across different strains.

What experimental controls are essential when characterizing enzyme activity of Recombinant Uncharacterized protein Rv0008c/MT0010?

When characterizing the potential enzymatic activity of Recombinant Uncharacterized protein Rv0008c/MT0010, these essential controls must be implemented:

  • Negative controls:

    • Buffer-only control (substrate in reaction buffer without protein)

    • Heat-denatured protein control (protein sample boiled for 10 minutes)

    • Irrelevant protein control (non-related protein of similar size/structure)

  • Positive controls:

    • Known enzyme with similar predicted activity

    • Commercially available enzyme that catalyzes the same reaction

    • Previously characterized protein from the same family (if available)

  • Experimental validation controls:

    • pH variation series (testing activity across pH range 5.0-9.0)

    • Temperature gradient experiments (testing activity at 4°C, 25°C, 37°C, 42°C)

    • Metal ion dependency tests (with and without potential cofactors)

    • Substrate concentration gradient (for kinetic parameter determination)

  • Technical controls:

    • Multiple protein batches to account for preparation variability

    • Different storage time points to assess stability

    • Fresh vs. freeze-thawed samples to evaluate activity loss

These controls help distinguish true enzymatic activity from artifacts and provide confidence in the characterization of previously uncharacterized proteins.

What expression systems are most effective for producing Recombinant Uncharacterized protein Rv0008c/MT0010?

For optimal expression of Recombinant Uncharacterized protein Rv0008c/MT0010, several expression systems should be considered, with baculovirus being particularly effective for proteins of Mycobacterium tuberculosis origin . Each system offers distinct advantages:

  • Baculovirus Expression System:

    • Preferred for Mycobacterium tuberculosis proteins requiring eukaryotic post-translational modifications

    • Allows for production of proteins toxic to bacterial hosts

    • Provides higher yields for complex proteins

    • Supports proper folding of larger proteins

  • E. coli Expression System:

    • Rapid growth and high protein yields

    • Cost-effective production

    • Well-established protocols for optimization

    • Suitable for proteins that don't require complex modifications

  • Mammalian Expression System:

    • Provides most authentic post-translational modifications

    • Ideal for proteins requiring complex folding

    • Supports native-like protein conformation

    • Allows for stable cell line development for continuous production

A comparative analysis of expression yields and activity for similar Mycobacterium tuberculosis proteins across different systems:

Expression SystemTypical Yield (mg/L)Relative ActivityPurification ComplexityCost
Baculovirus5-50HighMediumMedium-High
E. coli10-100Medium-LowLowLow
Mammalian1-20Very HighHighHigh
Cell-free0.5-10MediumVery LowVery High

The choice of expression system should be based on the specific experimental requirements, including the need for post-translational modifications, protein solubility, and downstream applications.

How can researchers verify the purity and integrity of Recombinant Uncharacterized protein Rv0008c/MT0010 preparations?

To ensure the highest quality of Recombinant Uncharacterized protein Rv0008c/MT0010 preparations, researchers should implement a multi-method verification approach:

  • SDS-PAGE Analysis:

    • Run protein samples on 10-12% polyacrylamide gels

    • Verify a single band at the expected molecular weight

    • Compare against molecular weight markers

    • Aim for purity >85% as assessed by densitometry

  • Western Blot Verification:

    • Use antibodies specific to the protein or to any tags included in the construct

    • Confirm single band at the expected size

    • Check for absence of degradation products

  • Mass Spectrometry Analysis:

    • Perform peptide mass fingerprinting to confirm protein identity

    • Use intact protein mass analysis to verify full-length expression

    • Check for post-translational modifications or unexpected truncations

  • Functional Assays:

    • Perform activity tests if function is known or hypothesized

    • Compare activity to reference standards if available

    • Assess batch-to-batch consistency in activity

  • Biophysical Characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Size-exclusion chromatography to verify monomeric state/oligomerization

    • Dynamic light scattering to check for aggregation

These verification methods should be performed on each new batch of protein, with documentation of results to ensure experimental reproducibility and reliability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.