Recombinant Uncharacterized protein Rv0010c/MT0013 (Rv0010c, MT0013)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Uncharacterized protein Rv0010c/MT0013, also known as Rv0010c or MT0013, is a protein that has been identified in Mycobacterium tuberculosis (Mtb) . It is also referred to as Uncharacterized protein Rv0010c/MT0013 or hypothetical protein Rv0010c .

Basic Characteristics

CharacteristicDescription
NamesRecombinant Uncharacterized protein Rv0010c/MT0013 (Rv0010c; MT0013); Uncharacterized protein Rv0010c/MT0013; hypothetical protein Rv0010c
SourceMycobacterium tuberculosis
HostE. coli, Yeast, Baculovirus, or Mammalian Cell
PurityGreater or equal to 85% purity as determined by SDS-PAGE
UniProt Accession NumberP71580

Role in Drug Resistance

  • Isoniazid Resistance Variants in dnaA, an essential replication initiation factor in Mtb, are linked to drug resistance across independent studies . Mutations in dnaA and a DnaA interacting site in the Rv0010c-Rv0011c intergenic region can cause changes in susceptibility to isoniazid (INH), a key first-line anti-tuberculosis drug, leading to increased resistance .

Involvement with Clp Machinery

The unfoldase ClpC1 of Mycobacterium tuberculosis regulates dosage-sensitive proteins . Studies indicate the Clp machinery affects proteins, including conserved hypothetical proteins like Rv0038 and uncharacterized proteins like Rv0106 .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Target Names
Rv0010c, MT0013
Target Protein Sequence
MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAALGLILFASATWRARPR LAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEIETVSGGLLILSRWDLG TDPVEVLDALTAAGYAGRGQR
Uniprot No.

Q&A

What is Recombinant Uncharacterized protein Rv0010c/MT0013?

Recombinant Uncharacterized protein Rv0010c/MT0013 is a membrane protein from Mycobacterium tuberculosis that has not yet been fully characterized in terms of function. According to NCBI database information, it is identified with GeneID 887082 and Accession number P71580.1 . The protein is classified as a membrane protein, suggesting it plays a role in the cellular membrane structure or function of M. tuberculosis. For research purposes, this protein can be produced recombinantly in various host systems including E. coli, yeast, baculovirus, or mammalian cell expression systems to facilitate in vitro studies of its properties . The recombinant version typically includes an N-terminal tag and may also contain a C-terminal tag to aid in purification and detection, with tag types determined based on various factors including tag-protein stability .

Why is studying Rv0010c/MT0013 significant in tuberculosis research?

Studying uncharacterized proteins like Rv0010c/MT0013 is crucial for advancing tuberculosis research for several compelling reasons. As a membrane protein in M. tuberculosis, Rv0010c/MT0013 represents a potential therapeutic target, particularly given that membrane proteins often mediate essential cellular functions including transport, signaling, and interaction with the host environment. The emergence of drug-resistant tuberculosis strains has intensified the need to identify and characterize novel drug targets, making proteins like Rv0010c/MT0013 valuable subjects for investigation . Recent advances in genomic analysis and machine learning approaches have significantly enhanced our ability to predict potential functions and drug resistance associations of previously uncharacterized proteins, opening new avenues for tuberculosis treatment strategies . Understanding the role of Rv0010c/MT0013 could potentially reveal new mechanisms contributing to M. tuberculosis pathogenesis or drug resistance, addressing significant gaps in our knowledge of tuberculosis biology.

What are the recommended storage and handling conditions for Rv0010c/MT0013?

The proper storage and handling of Rv0010c/MT0013 recombinant protein is essential for maintaining its structural integrity and functional properties during research applications. According to manufacturer specifications, the protein should be stored at -20°C for routine short-term storage, while long-term storage should be at -20°C or -80°C to minimize degradation . When working with small volumes of the protein, researchers should be aware that the product may occasionally become entrapped in the seal of the product vial during shipment and storage; in such cases, briefly centrifuging the vial on a tabletop centrifuge is recommended to dislodge any liquid in the container's cap . For optimal stability, working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of functionality . When preparing the protein for experimental use, researchers should consider using appropriate buffers containing stabilizing agents such as glycerol, and potentially include detergents suitable for membrane proteins to maintain proper folding.

What experimental design approaches are most effective for studying the function of Rv0010c/MT0013?

Effective experimental design for studying uncharacterized proteins like Rv0010c/MT0013 requires a comprehensive multi-technique approach that addresses the challenges inherent to membrane proteins. A well-designed experimental strategy should include both genetic approaches (gene knockout or knockdown studies, complementation analyses, and site-directed mutagenesis) and proteomic methods (protein-protein interaction studies, subcellular localization analyses, and structural investigations) . When designing these experiments, researchers must carefully consider variable properties of the experimental subject, properly define and control manipulated variables, ensure accurate measurement of outcomes, and account for biological variability—all key areas where difficulties in experimental design have been documented . Computational approaches, including homology modeling and sequence-based function prediction using machine learning, can provide valuable guidance for experimental design, especially when working with uncharacterized proteins . A comprehensive experimental design should also include appropriate controls at every stage, including empty vector controls, irrelevant protein controls, and specific positive controls, to ensure valid interpretation of results.

The table below outlines a recommended experimental design framework:

Experimental ApproachPrimary TechniquesControls RequiredExpected Outcomes
Genetic AnalysisGene knockout, complementationEmpty vector, dose controlPhenotypic changes indicating function
Protein InteractionPull-down assays, Co-IPNon-specific binding controlIdentification of interaction partners
Structural StudiesX-ray crystallography, Cryo-EMDetergent-only controlStructural insights into function
LocalizationFractionation, ImmunolocalizationFraction purity markersCellular context of protein
Functional AssaysContext-dependent assaysNegative and positive controlsDirect evidence of biochemical activity

How can machine learning approaches be applied to predict functional characteristics of Rv0010c/MT0013?

Machine learning approaches offer powerful tools for predicting functional characteristics of uncharacterized proteins like Rv0010c/MT0013, particularly when experimental data is limited. Recent research has demonstrated the effectiveness of several machine learning models in analyzing mycobacterial proteins, with the Extreme Gradient Boosting Classifier (XGBC) showing particularly impressive performance metrics, including sensitivity values of 0.90-0.97 and specificity values of 0.96-0.99 for various predictions related to M. tuberculosis proteins . For Rv0010c/MT0013 analysis, researchers could implement a prediction pipeline that begins with feature extraction from the protein's primary amino acid sequence, followed by training on datasets of known membrane proteins with similar characteristics. Performance evaluation should employ multiple metrics including sensitivity, specificity, precision, and F1-score to ensure robust predictions . When applying machine learning to predict drug resistance associations, researchers have found that using a binary representation of mutations together with the XGBC model yields superior results compared to other approaches, suggesting this as a promising methodology for analyzing uncharacterized proteins like Rv0010c/MT0013 .

Implementation requires careful consideration of data preprocessing, feature selection, cross-validation protocols, and performance evaluation metrics, with sensitivity, specificity, precision, and F1-score being particularly informative for evaluating prediction quality in the context of bacterial proteins . The predictions generated through machine learning should be considered hypotheses to be verified through targeted experimental approaches, creating an iterative cycle of computational prediction and experimental validation.

What challenges exist in determining the structure-function relationship of Rv0010c/MT0013?

Determining the structure-function relationship of Rv0010c/MT0013 presents significant challenges inherent to membrane proteins, requiring specialized methodological approaches. As a membrane protein, Rv0010c/MT0013 contains hydrophobic domains that make it difficult to express, purify, and crystallize using standard protocols developed for soluble proteins . The challenges begin at the expression stage, where researchers must select appropriate host systems (E. coli, yeast, baculovirus, or mammalian cells) that can properly fold the protein while producing sufficient quantities for structural studies . Purification requires careful selection of detergents or lipid environments to maintain the protein's native conformation while extracting it from the membrane, with the choice significantly impacting downstream structural analysis . Structural determination techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy each present their own challenges when applied to membrane proteins, often requiring specialized adaptations like lipidic cubic phase crystallization.

Without established functional assays for this uncharacterized protein, researchers face the additional challenge of correlating any structural information obtained with potential functions. This often necessitates comparative approaches, using structural similarities with proteins of known function to generate functional hypotheses. The challenge is further compounded by the potential for context-dependent functions that may vary under different physiological conditions or require specific interaction partners present in the native M. tuberculosis environment but absent in recombinant systems.

How does Rv0010c/MT0013 potentially contribute to drug resistance in Mycobacterium tuberculosis?

The potential contribution of Rv0010c/MT0013 to drug resistance in Mycobacterium tuberculosis can be examined through several mechanistic hypotheses and research approaches. As a membrane protein, Rv0010c/MT0013 could potentially function in drug efflux systems that expel antibiotics, alter cell envelope permeability to reduce drug penetration, or interact with known drug targets, modifying their accessibility to antimicrobial compounds . Advanced genomic analysis using machine learning approaches has shown promise in identifying and characterizing mutations associated with drug resistance in M. tuberculosis, with some models achieving high accuracy in predicting resistance to first-line drugs like ethambutol, isoniazid, and rifampicin . The Extreme Gradient Boosting Classifier (XGBC) model has demonstrated particularly impressive performance in classifying drug resistance, with sensitivity values of 0.97, 0.90, and 0.94 and specificity values of 0.97, 0.99, and 0.96 for ethambutol, isoniazid, and rifampicin, respectively .

To investigate Rv0010c/MT0013's potential role in drug resistance, researchers could employ several experimental approaches, including overexpression studies to determine if elevated levels confer resistance, gene knockout or knockdown to assess sensitivity changes to first-line drugs, and site-directed mutagenesis of specific residues identified in resistant strains. These experimental results could then be integrated with computational predictions to develop a more comprehensive understanding of how this uncharacterized protein might influence the drug resistance phenotype in M. tuberculosis.

What are the optimal expression systems for producing recombinant Rv0010c/MT0013?

The selection of optimal expression systems for producing recombinant Rv0010c/MT0013 depends on research objectives and downstream applications, with each system offering distinct advantages and limitations. According to available research data, recombinant Rv0010c/MT0013 can be expressed in various host systems including E. coli, yeast, baculovirus, or mammalian cell expression systems . For basic biochemical studies and initial characterization, E. coli expression systems (particularly strains optimized for membrane proteins like C41(DE3) and C43(DE3)) often provide the best balance of yield and simplicity, though careful optimization of induction conditions is necessary to avoid inclusion body formation . For structural studies requiring proper folding and post-translational modifications, insect cell/baculovirus systems or Pichia pastoris often yield higher-quality protein, albeit at increased cost and complexity .

When expressing Rv0010c/MT0013, researchers should carefully consider tag placement, as this can significantly impact protein folding and function – both N-terminal and C-terminal tags may be employed depending on protein topology and experimental requirements . Expression vectors should ideally include detergent resistance markers and strong but controllable promoters to manage expression levels, as membrane protein overexpression can be toxic to host cells. Regardless of the chosen system, expression conditions should be optimized through small-scale pilot experiments before scaling up, with particular attention to induction parameters, growth temperature, and harvest timing to maximize yield while maintaining protein quality.

What purification strategies yield the highest quality Rv0010c/MT0013 for structural studies?

Purifying membrane proteins like Rv0010c/MT0013 for structural studies requires specialized strategies to maintain native conformation while achieving high purity. The purification process typically begins with membrane extraction using appropriate detergents, with mild detergents like DDM or LMNG often preferred for initial screening as they balance extraction efficiency with preserving protein structure . Following extraction, a multi-step purification strategy is recommended, typically starting with immobilized metal affinity chromatography (IMAC) utilizing the N-terminal or C-terminal tags present on the recombinant protein . This initial capture step should be followed by additional purification methods such as ion exchange chromatography and size exclusion chromatography to remove contaminants and ensure sample homogeneity, which is critical for structural studies .

Quality assessment at each purification stage is essential, with techniques including SDS-PAGE to confirm purity (aiming for ≥85% as determined by SDS-PAGE for research applications, though structural studies typically require ≥95%), dynamic light scattering to assess homogeneity, and thermal shift assays to verify stability . For structural techniques like X-ray crystallography or cryo-electron microscopy, additional considerations include optimizing detergent-lipid mixtures for crystallization or testing alternative membrane mimetics like nanodiscs or saposin-lipoprotein nanoparticles that may better stabilize the protein. Throughout the purification process, maintaining a controlled environment (typically 4°C) and including appropriate stabilizers in buffers helps preserve the functional integrity of this uncharacterized membrane protein.

How can researchers validate the functional integrity of purified Rv0010c/MT0013?

Validating the functional integrity of purified Rv0010c/MT0013 presents a unique challenge due to its uncharacterized nature, requiring a multi-faceted approach that assesses various aspects of protein quality. Structural integrity assessment forms the foundation of validation, employing techniques such as circular dichroism spectroscopy to confirm secondary structure content, intrinsic tryptophan fluorescence to assess tertiary structure, and thermal shift assays to determine stability and proper folding . As a membrane protein, Rv0010c/MT0013 requires additional validations specific to its membrane nature, including reconstitution into liposomes or nanodiscs to verify membrane integration, orientation analysis in proteoliposomes, and assessment of oligomeric state in membrane-mimetic environments . In the absence of known functional activities, researchers can employ binding assays to identify potential ligands or interaction partners, using techniques such as surface plasmon resonance, microscale thermophoresis, or pull-down assays with cellular lysates.

For more comprehensive validation, comparative approaches can be valuable, analyzing purified Rv0010c/MT0013 in parallel with related proteins of known function or comparing the recombinant protein with native protein extracted from M. tuberculosis when feasible. Each validation method provides complementary information, and researchers should select a combination of techniques appropriate to their downstream applications, with more stringent quality requirements for structural studies compared to basic biochemical characterization. Documentation of validation results according to established criteria provides crucial quality control for subsequent experiments and enables meaningful comparison of results across different research groups studying this uncharacterized protein.

What controls should be included in experimental designs involving Rv0010c/MT0013?

Robust experimental designs involving Rv0010c/MT0013 require comprehensive controls to ensure valid interpretation of results and account for potential confounding factors. For expression and purification experiments, essential controls include an empty vector expression to identify background contaminants, a positive control using a well-characterized membrane protein expressed under identical conditions, and a tag-only control to assess the contribution of purification tags to observed results . In binding and interaction assays, non-specific binding controls (using irrelevant proteins with similar biochemical properties), competitive binding controls, and detergent micelle controls are crucial to distinguish protein-specific interactions from artifacts . When conducting genetic experiments, vector-only controls, irrelevant protein expression controls, and complementation specificity controls help establish the specificity of observed phenotypes to Rv0010c/MT0013 function.

How can variability in Rv0010c/MT0013 expression be accounted for in experimental designs?

Accounting for variability in Rv0010c/MT0013 expression is crucial for generating reproducible and reliable research outcomes, particularly given the challenges inherent to membrane protein expression. Sources of variability include biological factors (strain differences, plasmid stability), technical factors (media composition, induction conditions), and protein-specific factors (toxicity, proteolytic susceptibility) . To address these variables, experimental designs should incorporate appropriate replicate structures, including a minimum of three biological replicates (independent transformations or cultures) and multiple technical replicates within each biological replicate . Standardization approaches such as consistent cell density for induction (measured by OD600), normalized protein loading based on total protein concentration, and defined harvest points based on growth curves rather than absolute time help minimize variability across experiments .

What are the recommended methodologies for investigating protein-protein interactions involving Rv0010c/MT0013?

Investigating protein-protein interactions involving a membrane protein like Rv0010c/MT0013 requires specialized methodologies that account for its hydrophobic nature and membrane environment. Affinity-based methods represent a primary approach, including pull-down assays using tagged recombinant Rv0010c/MT0013, co-immunoprecipitation with specific antibodies, and chemical cross-linking followed by mass spectrometry (XL-MS) . These techniques should be adapted for membrane proteins by including appropriate detergents or membrane mimetics to maintain protein structure while allowing interactions to occur. For more comprehensive interaction screening, library approaches such as bacterial two-hybrid systems adapted for membrane proteins or split-ubiquitin membrane yeast two-hybrid systems can identify novel interaction partners from genomic or cDNA libraries .

Biophysical techniques provide quantitative interaction data, with surface plasmon resonance (SPR), microscale thermophoresis, or isothermal titration calorimetry offering insights into binding kinetics and thermodynamics . For in vivo validation, techniques such as bimolecular fluorescence complementation (BiFC), proximity-dependent biotin identification (BioID), or co-localization studies using fluorescently tagged proteins can confirm interactions in a cellular context more closely resembling the native environment. Throughout all interaction studies, researchers must implement appropriate controls for non-specific binding, detergent effects, and tag interference to ensure the biological relevance of detected interactions. The combination of multiple orthogonal techniques is strongly recommended to validate interactions and distinguish direct from indirect associations, providing a more complete and reliable interactome for this uncharacterized membrane protein.

How should researchers approach the analysis of Rv0010c/MT0013 sequence variations across clinical isolates?

Analyzing sequence variations in Rv0010c/MT0013 across clinical isolates requires a structured approach that combines genomic analysis with functional interpretation. Researchers should begin by collecting whole genome sequencing (WGS) data from diverse M. tuberculosis clinical isolates, ensuring representation of different lineages, geographic origins, and drug resistance profiles . Bioinformatic analysis should identify both synonymous and non-synonymous mutations, with particular attention to mutations that may affect protein function, such as those in predicted functional domains or transmembrane regions. For systematic analysis of mutation patterns, machine learning approaches have shown considerable promise, with models like the Extreme Gradient Boosting Classifier (XGBC) demonstrating high performance in classifying the significance of mutations in mycobacterial proteins .

The biological significance of identified variations can be assessed through correlation with phenotypic data, particularly drug resistance profiles, with statistical methods employed to distinguish significant associations from random patterns . For mutations of interest, experimental validation through site-directed mutagenesis and functional assays provides direct evidence of impact on protein function or drug susceptibility. Structural modeling can provide additional insights by predicting how specific mutations might alter protein folding, stability, or interaction surfaces. This integrated approach, combining computational analysis with experimental validation, enables researchers to move beyond cataloging mutations to understanding their functional implications for tuberculosis pathogenesis and treatment resistance.

What are the most promising future research directions for understanding Rv0010c/MT0013 function?

The uncharacterized nature of Rv0010c/MT0013 presents both challenges and opportunities for future research, with several promising directions likely to yield significant insights. Integration of advanced computational approaches with experimental validation represents perhaps the most efficient pathway forward, with machine learning models demonstrating particular promise for predicting protein function and drug resistance associations based on sequence and structural features . CRISPR-based functional genomics approaches offer powerful tools for systematically investigating the role of Rv0010c/MT0013 in M. tuberculosis physiology and pathogenesis, potentially revealing condition-specific phenotypes not apparent under standard laboratory conditions. Structural biology techniques optimized for membrane proteins, particularly cryo-electron microscopy which has revolutionized membrane protein structural determination, could provide crucial insights into Rv0010c/MT0013 structure and potential binding sites.

Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data can place Rv0010c/MT0013 in its broader cellular context, revealing functional associations through guilt-by-association principles. Single-cell techniques examining expression patterns during infection could illuminate the protein's role in host-pathogen interactions. From a translational perspective, exploring Rv0010c/MT0013 as a potential diagnostic biomarker or therapeutic target represents an important direction, particularly if the protein is found to contribute to drug resistance mechanisms. These multidisciplinary approaches, combined with rigorous experimental design and appropriate controls, offer the best path toward unraveling the function of this enigmatic protein and potentially contributing to improved tuberculosis control strategies.

How might understanding Rv0010c/MT0013 contribute to tuberculosis therapeutic strategies?

Understanding the function of Rv0010c/MT0013 could significantly contribute to tuberculosis therapeutic strategies through several potential pathways. If functional characterization reveals that Rv0010c/MT0013 plays a role in drug resistance mechanisms, this knowledge could inform the development of adjuvant therapies that target this protein to restore antibiotic sensitivity . As a membrane protein, Rv0010c/MT0013 might participate in essential cellular processes like nutrient uptake, signaling, or cell wall maintenance, potentially representing a novel target for antibiotic development – particularly valuable given the urgent need for new tuberculosis therapeutics effective against resistant strains . The protein might also be involved in host-pathogen interactions or immune evasion strategies, suggesting its potential role in immunotherapeutic approaches that could complement conventional antibiotic treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.