Recombinant Uncharacterized protein Rv0090/MT0099 (Rv0090, MT0099)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Target Names
Rv0090, MT0099
Target Protein Sequence
MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEVWRCLRCGDFALGGPQ GRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAVWEFRGARGAIQATLDR DLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYAVLQAVEGVGLWLLKRWG EYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLLISKRLFGVRGGRKAYDVE RRGEQLLDLERAAMLT
Uniprot No.

Q&A

What is Rv0090/MT0099 and where is it located in the Mycobacterium tuberculosis genome?

Rv0090 is classified as a possible membrane protein in Mycobacterium tuberculosis. According to genomic mapping, it is located at position 98480-99250 on the positive strand of the M. tuberculosis genome, with a nucleotide length of 771 bp encoding a protein of 256 amino acids . The protein is also referenced as MT0099 in some strain annotations. This gene is situated within a region known as RD108 (spanning positions 96640-99257), which is a region that can be deleted in certain M. tuberculosis strains, particularly the Beijing/W lineage .

What are the basic approaches for expressing and purifying recombinant Rv0090/MT0099?

For recombinant expression of Rv0090/MT0099, researchers typically employ the following methodological workflow:

  • Gene amplification: PCR amplification of the Rv0090 gene from M. tuberculosis genomic DNA

  • Cloning: Insertion into an appropriate expression vector (typically with a His-tag or other affinity tag)

  • Expression system selection: Testing in various systems including:

    • E. coli BL21(DE3) for standard expression

    • Mycobacterial expression systems for more native-like folding

    • Cell-free systems for membrane proteins that may be toxic when overexpressed

  • Purification: Using affinity chromatography followed by size exclusion chromatography

  • Detergent screening: For membrane proteins like Rv0090, systematically testing detergents such as DDM, LDAO, or CHAPS for optimal solubilization

Since Rv0090 is predicted to be a membrane protein, special attention should be given to maintaining its stability during the purification process by selecting appropriate detergents and buffer conditions .

How is Rv0090/MT0099 genetically regulated in Mycobacterium tuberculosis?

Rv0090 displays a specific pattern of co-regulation within the M. tuberculosis genome. Quantitative analysis shows that it is predicted to be co-regulated in two main modules:

  • Bicluster_0207 with a residual value of 0.51

  • Bicluster_0568 with a residual value of 0.57

This regulation is potentially mediated by de-novo identified cis-regulatory motifs with specific e-values:

  • Bicluster_0207: motifs with e-values of 150.00 and 95.00

  • Bicluster_0568: motifs with e-values of 68.00 and 380.00

These modules are enriched for primary metabolic processes and cellular metabolic processes, suggesting Rv0090's involvement in these fundamental cellular functions.

What experimental approaches can determine the membrane topology of Rv0090/MT0099?

Determining the membrane topology of Rv0090 requires a multi-faceted experimental approach:

  • Computational prediction: Initial topology models using algorithms such as TMHMM, HMMTOP, and TOPCONS to predict transmembrane regions and orientation.

  • Experimental validation: Several complementary methods should be employed:

    a. Cysteine scanning mutagenesis:

    • Systematically replace residues with cysteine

    • Expose to membrane-impermeable thiol-reactive reagents

    • Analyze accessibility patterns to determine which regions are exposed to which side of the membrane

    b. Reporter fusion approach:

    • Create fusion constructs with reporter proteins (e.g., GFP, alkaline phosphatase)

    • The activity/fluorescence of the reporter indicates the topology of the fusion site

    c. Protease protection assays:

    • Express the protein in membrane vesicles

    • Treat with proteases

    • Analyze protected fragments by immunoblotting

    • Protected regions are those within the membrane or facing the vesicle lumen

  • Structural biology techniques:

    • Cryo-electron microscopy for higher-resolution structural information

    • Solid-state NMR for specific structural constraints

These approaches would help establish the orientation of Rv0090 in the membrane and identify key functional domains that may interact with other cellular components or substrates .

How does the deletion of Rv0090 in Beijing/W strains affect cholesterol metabolism and bacterial fitness?

The deletion of Rv0090 as part of the RD108 region in Beijing/W strains presents an intriguing research question regarding metabolic adaptation. To systematically investigate this:

  • Comparative growth studies:

    • Compare growth rates of wild-type and Rv0090 deletion strains in media with cholesterol as the sole carbon source

    • Monitor growth under various stress conditions to assess fitness costs of the deletion

  • Metabolic flux analysis:

    • Trace 13C-labeled cholesterol metabolism in both wild-type and deletion strains

    • Identify metabolic branch points and possible compensatory pathways activated in deletion strains

  • Transcriptomic profiling:

    • RNA-seq analysis comparing wild-type and Rv0090 deletion strains grown with or without cholesterol

    • Identify differentially regulated genes that may compensate for Rv0090 loss

  • Protein-protein interaction studies:

    • Identify binding partners of Rv0090 using pull-down assays and mass spectrometry

    • Determine if these interactions are critical for cholesterol utilization

The fact that Rv0090 has been found to be associated with growth on cholesterol suggests it plays a role in cholesterol metabolism, yet its deletion in certain successful strains like Beijing/W indicates either functional redundancy or adaptive compensatory mechanisms .

What is the significance of Rv0090/MT0099 co-regulation with other genes in specific biclusters?

The co-regulation of Rv0090 within specific biclusters suggests functional relationships that can be explored through:

  • Network analysis methodology:

    • Construct gene co-expression networks from transcriptomic data across multiple conditions

    • Identify hub genes within biclusters 0207 and 0568

    • Apply topological overlap measures to strengthen network connections

  • Functional enrichment analysis:

    • Perform Gene Ontology enrichment for all genes in biclusters 0207 and 0568

    • Use KEGG pathway mapping to identify overrepresented metabolic or signaling pathways

  • Protein domain analysis:

    • Examine protein domains across co-regulated genes to identify functional patterns

    • Look for enrichment of specific protein families or motifs

  • Experimental validation:

    • Create knockouts of multiple genes within the same bicluster

    • Compare phenotypes to single Rv0090 knockout to identify synergistic effects

    • Perform ChIP-seq to identify common transcriptional regulators

The current data suggests enrichment for primary metabolic processes and cellular metabolic processes in these biclusters, indicating Rv0090 may play a role in metabolic adaptation or regulation .

BiclusterResidual ValueCis-regulatory Motif E-valuesEnriched GO Terms
02070.51150.00, 95.00Primary metabolic process, Cellular metabolic process
05680.5768.00, 380.00Primary metabolic process, Cellular metabolic process

How can the genomic deletion of Rv0090 in RD108 be leveraged for strain typing and epidemiological studies?

The deletion of Rv0090 as part of the RD108 region in Beijing/W strains provides a genetic marker for epidemiological investigations. Researchers can implement the following methodological approaches:

  • PCR-based deletion mapping:

    • Design primers flanking the RD108 region (96640-99257)

    • Develop a multiplex PCR assay that can distinguish between strains with and without the deletion

    • Optimize for high-throughput screening of clinical isolates

  • Whole genome sequencing analysis workflow:

    • Implement bioinformatic pipelines to rapidly identify RD108 deletions

    • Correlate with other phylogenetic markers to improve classification accuracy

    • Develop machine learning algorithms to predict strain lineages based on deletion patterns

  • Geographic distribution analysis:

    • Map the prevalence of RD108 deletions across different geographical regions

    • Correlate with patient demographics and clinical outcomes

    • Identify transmission patterns specific to Beijing/W strains

  • Evolutionary studies:

    • Estimate the timing of the RD108 deletion event using molecular clock analyses

    • Investigate whether the deletion represents a selective advantage in specific environments

    • Examine the stability of the deletion across generations

This genomic region, which includes Rv0090 and spans positions 96640-99257 with a size of 2,617 bp, can serve as a reliable marker for identifying Beijing/W strains in clinical and research settings .

What techniques are recommended for functional characterization of Rv0090/MT0099?

For comprehensive functional characterization of Rv0090, researchers should consider implementing the following methodological framework:

  • Gene knockout and complementation:

    • Generate precise gene deletions using specialized mycobacterial recombineering systems

    • Create complementation strains with the wild-type gene under inducible promoters

    • Develop conditional knockdowns using CRISPRi for essential genes

  • Phenotypic profiling:

    • Perform high-throughput phenotypic microarrays to identify growth conditions affected by Rv0090 deletion

    • Assess intracellular survival in macrophage infection models

    • Evaluate resistance to various stress conditions (oxidative, nitrosative, acid stress)

  • Localization studies:

    • Use fluorescent protein fusions to determine subcellular localization

    • Perform immunogold electron microscopy for high-resolution localization

    • Conduct fractionation studies followed by immunoblotting to confirm membrane association

  • Interactome mapping:

    • Perform bacterial two-hybrid screens to identify protein-protein interactions

    • Use co-immunoprecipitation followed by mass spectrometry to identify native complexes

    • Employ crosslinking mass spectrometry to capture transient interactions

  • Substrate identification:

    • Develop activity assays based on predicted function

    • Perform metabolomics analyses comparing wild-type and knockout strains

    • Use labeled substrate analogs to track potential enzymatic activity

Since Rv0090 is found to be related to growth on cholesterol, specific assays measuring cholesterol uptake, metabolism, or regulation would be particularly informative .

How can researchers resolve contradictory findings regarding Rv0090/MT0099 function in different M. tuberculosis strains?

When faced with contradictory findings regarding Rv0090 function across different strains, a systematic approach to resolution involves:

  • Standardized experimental conditions:

    • Develop a consortium-agreed set of growth conditions and assay protocols

    • Ensure genetic constructs use identical promoters and tags across labs

    • Implement blinded analysis of phenotypic data

  • Comprehensive strain characterization:

    • Perform whole-genome sequencing of all strains used in contradictory studies

    • Identify background mutations that might influence phenotypic outcomes

    • Create a database of strain-specific genomic variations

  • Epistasis analysis:

    • Identify genetic interactions by creating double/triple mutants

    • Screen for suppressor mutations that restore function in deletion strains

    • Map genetic networks that could explain strain-specific differences

  • Environmental variable control:

    • Systematically test the influence of media composition on phenotypic differences

    • Evaluate host cell factors in infection models that might interact differently with various strains

    • Examine growth phase-dependent effects on protein function

  • Meta-analysis methodology:

    • Develop quantitative models to integrate data from multiple studies

    • Apply Bayesian approaches to weight evidence based on methodological rigor

    • Identify patterns in contradictory data that might reveal condition-dependent functions

This approach is particularly relevant when considering the functional implications of Rv0090 deletion in Beijing/W strains compared to its retention in other lineages, which suggests potential strain-specific adaptations or compensatory mechanisms .

What are the optimal approaches for studying the structure-function relationship of Rv0090/MT0099?

Investigating the structure-function relationship of membrane proteins like Rv0090 requires specialized techniques and considerations:

This methodological framework provides a comprehensive approach to understanding how Rv0090's structural features contribute to its function in membrane processes and cholesterol metabolism .

How can Rv0090/MT0099 be targeted for developing novel TB diagnostics?

The genomic context of Rv0090, particularly its deletion in Beijing/W strains, presents unique opportunities for diagnostic development:

  • PCR-based detection systems:

    • Design primer pairs specific to the RD108 region containing Rv0090

    • Develop multiplex PCR assays that can simultaneously detect multiple RD regions

    This approach would allow strain typing directly from clinical samples .

  • Immunodiagnostic approach:

    • Express recombinant Rv0090 protein

    • Develop monoclonal antibodies against conserved epitopes

    • Design serological assays to detect immune responses to Rv0090 in patients

    • Create antigen detection assays for direct diagnosis

  • CRISPR-based diagnostics:

    • Design guide RNAs targeting the Rv0090 region

    • Implement CRISPR-Cas12 or Cas13 systems for highly sensitive detection

    • Develop point-of-care compatible detection platforms

  • Bioinformatic strain identification:

    • Create databases of strain-specific deletion patterns

    • Develop algorithms to rapidly classify clinical isolates based on WGS data

    • Link strain types to clinical outcomes and drug resistance profiles

The presence or absence of Rv0090 could serve as a marker for Beijing/W strains, which are often associated with drug resistance and specific geographical distributions, potentially allowing for more targeted treatment approaches .

What is the potential of Rv0090/MT0099 as a drug target for tuberculosis treatment?

Evaluating Rv0090 as a potential drug target involves systematic assessment:

  • Target validation methodology:

    • Determine essentiality using conditional knockdown systems

    • Assess contribution to virulence in animal infection models

    • Evaluate role in persistence and dormancy

  • Druggability assessment:

    • Identify potential binding pockets using structural analysis

    • Assess conservation across clinical isolates to predict resistance development

    • Evaluate structural similarity to human proteins to predict off-target effects

  • High-throughput screening strategy:

    • Develop activity-based assays suitable for compound libraries

    • Design whole-cell screens with reporter systems linked to Rv0090 function

    • Implement fragment-based drug discovery approaches for membrane proteins

  • Structure-based drug design:

    • Generate pharmacophore models based on predicted functional sites

    • Perform virtual screening against commercial compound libraries

    • Design rational inhibitors targeting cholesterol-binding domains if present

  • Resistance mechanism prediction:

    • Analyze the implications of natural deletion in Beijing/W strains

    • Evaluate potential compensatory pathways that might limit drug efficacy

    • Assess genetic barriers to resistance development

What high-throughput approaches can be used to study the interaction network of Rv0090/MT0099?

To comprehensively map the interaction network of Rv0090, researchers should implement a multi-layered approach:

  • Protein-protein interaction mapping:

    • Bacterial two-hybrid screening adapted for membrane proteins

    • Split-protein complementation assays (e.g., DHFR, luciferase)

    • Proximity-dependent biotinylation (BioID) adapted for bacterial systems

    • Co-immunoprecipitation followed by mass spectrometry

  • Genetic interaction screening:

    • CRISPRi-based double knockdown screens

    • Transposon insertion sequencing (TnSeq) in Rv0090 mutant background

    • Synthetic genetic array analysis adapted for mycobacteria

  • Transcriptional network analysis:

    • ChIP-seq to identify transcription factors binding near Rv0090

    • RNA-seq comparing wild-type and Rv0090 knockout strains

    • ATAC-seq to examine chromatin accessibility around the Rv0090 locus

  • Metabolic network integration:

    • Untargeted metabolomics comparing wild-type and Rv0090 mutants

    • Isotope tracing studies focusing on cholesterol metabolism

    • Flux balance analysis incorporating Rv0090-dependent reactions

  • Data integration framework:

    • Network visualization tools customized for mycobacterial interactomes

    • Machine learning approaches to predict functional associations

    • Database development for storing and comparing interaction data

Given that Rv0090 is co-regulated in modules with specific residual values (bicluster_0207 with 0.51 and bicluster_0568 with 0.57), special attention should be given to other genes within these biclusters as potential interaction partners .

How can researchers effectively model the evolutionary significance of Rv0090/MT0099 deletion in Beijing/W strains?

To model the evolutionary significance of Rv0090 deletion in Beijing/W strains, researchers should employ:

  • Phylogenetic analysis methodology:

    • Construct maximum likelihood trees using whole-genome sequences

    • Map RD108 deletion events onto the phylogeny

    • Estimate timing of deletion events using molecular clock approaches

    • Perform ancestral state reconstruction to trace the deletion's origins

  • Population genomics approach:

    • Calculate nucleotide diversity (π) and FST in regions flanking RD108

    • Implement tests for selective sweeps (Tajima's D, Fay & Wu's H)

    • Perform genome-wide association studies correlating RD108 deletion with phenotypic traits

    • Compare mutation rates in regions surrounding the deletion

  • Experimental evolution framework:

    • Culture wild-type strains under conditions mimicking those faced by Beijing/W strains

    • Sequence evolving populations to detect spontaneous deletions

    • Compete engineered RD108 deletion strains against wild-type under various conditions

    • Measure fitness effects in different host environments

  • Compensatory adaptation analysis:

    • Identify genetic changes co-occurring with RD108 deletion

    • Test for epistatic interactions between RD108 deletion and other mutations

    • Compare transcriptomes of wild-type and RD108-deleted strains to identify compensatory expression changes

The RD108 region spans 2,617 bp and contains multiple genes including Rv0090, which suggests that understanding the evolutionary implications requires considering potential epistatic effects and functional redundancy within the M. tuberculosis genome .

What methods can be used to investigate the role of Rv0090/MT0099 in host-pathogen interactions?

Investigating Rv0090's role in host-pathogen interactions requires specialized methodological approaches:

  • Infection model systems:

    • Macrophage infection assays comparing wild-type and Rv0090 knockout strains

    • Advanced cell culture models (granuloma-like structures, lung organoids)

    • Animal infection models with readouts for bacterial burden and immunopathology

    • Humanized mouse models for host-specific interactions

  • Host response analysis:

    • Transcriptomics of infected host cells (RNA-seq, single-cell RNA-seq)

    • Cytokine profiling during infection with wild-type vs. mutant strains

    • Phosphoproteomics to identify altered signaling pathways

    • Imaging mass cytometry for spatial analysis of host-pathogen interactions

  • Bacterial adaptation tracking:

    • RNA-seq of bacteria during infection to track expression changes

    • Transposon sequencing to identify genes with altered fitness requirements

    • Metabolic labeling to track changes in bacterial metabolism

    • Live cell imaging with reporter strains to visualize bacterial responses

  • Immune recognition studies:

    • Antigen presentation assays with recombinant Rv0090 protein

    • T-cell activation and proliferation assays

    • Mass spectrometry identification of Rv0090-derived peptides presented on MHC

    • Single-cell analysis of immune cell populations responding to infection

  • Strain comparison methodology:

    • Compare host responses to Beijing/W strains (lacking Rv0090) vs. other lineages

    • Complement Beijing/W strains with Rv0090 to assess phenotypic changes

    • Create reporter strains to track expression in different host environments

Since Rv0090 is a membrane protein potentially involved in cholesterol metabolism, special attention should be given to its role in bacterial survival within cholesterol-rich host environments and potential interactions with host membrane components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.