Recombinant Uncharacterized protein Rv0093c/MT0102 (Rv0093c, MT0102)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its inclusion.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Target Names
Rv0093c, MT0102
Target Protein Sequence
MLAQATTAGSFNHHASTVLQGCRGVPAAMWSEPAGAIRRHCATIDGMDCEVAREALSARL DGERAPVPSARVDEHLGECSACRAWFTQVASQAGDLRRLAESRPVVPPVGRLGIRRAPRR QHSPMTWRRWALLCVGIAQIALGTVQGFGLDVGLTHQHPTGAGTHLLNESTSWSIALGVI MVGAALWPSAAAGLAGVLTAFVAILTGYVIVDALSGAVSTTRILTHLPVVIGAVLAIMVW RSASGPRPRPDAVAAEPDIVLPDNASRGRRRGHLWPTDGSAA
Uniprot No.

Q&A

What is Rv0093c/MT0102 and what organism does it originate from?

Rv0093c/MT0102 is an uncharacterized protein originating from Mycobacterium tuberculosis. It is identified by Uniprot accession number Q10890 and is characterized as a full-length protein with an expression region spanning positions 1-282. The protein has recently been implicated as an anti-sigma factor interacting with Sigma Factor C (SigC) .

What gene names and loci are associated with this protein?

The protein is encoded by the following genomic identifiers:

  • Ordered Locus Names: Rv0093c, MT0102

  • ORF Names: MTCY251.12c

These designations reflect the genomic organization in different strains of M. tuberculosis and are essential for comparative genomic analyses .

How should recombinant Rv0093c/MT0102 be stored for optimal stability?

For optimal stability, recombinant Rv0093c/MT0102 should be stored in a Tris-based buffer containing 50% glycerol. Short-term storage can be at -20°C, while extended storage requires -20°C or preferably -80°C. To maintain protein integrity, repeated freezing and thawing should be avoided. For working solutions, store aliquots at 4°C for no more than one week. This storage protocol helps preserve the protein's structural integrity and biological activity for experimental use .

What are the recommended approaches for studying Rv0093c function using single-case experimental designs?

Single-case experimental designs (SCEDs) represent valuable methodological approaches for studying proteins like Rv0093c where limited prior characterization exists. Researchers should consider:

  • Reversal designs: Implement baseline measurements, introduce Rv0093c treatment/manipulation, then remove it to establish causal relationships.

  • Multiple baseline designs: Introduce Rv0093c across different experimental systems at staggered timepoints.

  • Combined designs: Integrate reversal and multiple baseline approaches for robust experimental control.

These approaches can help establish functional relationships between Rv0093c and observed outcomes, particularly when studying its role as an anti-sigma factor. To reduce threats to internal validity, randomize the order of experimental conditions and implement blinding procedures when possible for intervention and data collection processes .

How can researchers effectively express and purify recombinant Rv0093c/MT0102 for functional studies?

For effective expression and purification of recombinant Rv0093c/MT0102:

  • Expression system selection: Choose E. coli BL21(DE3) or similar strains for cytoplasmic proteins. For membrane-associated studies (given Rv0093c's potential membrane regions), consider M. smegmatis expression systems.

  • Optimization protocol:

    • Clone the full expression region (1-282) into a vector with an appropriate tag

    • Express at lower temperatures (16-18°C) to enhance solubility

    • Use Tris-based buffers with glycerol for stabilization

    • Implement a two-step purification protocol combining affinity chromatography with size exclusion

  • Quality assessment: Verify protein integrity using SDS-PAGE, Western blotting, and mass spectrometry before proceeding to functional assays.

The tag type should be determined during the production process based on the specific experimental needs and downstream applications .

What experimental controls are essential when evaluating Rv0093c as an anti-sigma factor?

When evaluating Rv0093c as a SigC-specific anti-sigma factor, essential experimental controls include:

  • Positive controls:

    • Known anti-sigma factor/sigma factor pairs (e.g., RshA/SigH)

    • Confirmed protein-protein interactions with similar binding properties

  • Negative controls:

    • Non-interacting sigma factors (to confirm specificity for SigC)

    • Mutated versions of Rv0093c with disrupted binding domains

  • Validation approaches:

    • Perform both in vitro binding assays (pull-down, SPR) and in vivo validation

    • Use knockout/complementation studies to demonstrate functional relevance

    • Include isogenic strain comparisons with and without Rv0093c expression

These controls help establish specificity of the interaction between Rv0093c and SigC, confirming its role as an anti-sigma factor while ruling out non-specific binding or experimental artifacts .

What is the current understanding of Rv0093c's role in copper metabolism?

The current understanding of Rv0093c's role in copper metabolism is still developing. Recent research has redefined SigC's implication in copper metabolism, with Rv0093c now identified as its specific anti-sigma factor. This relationship suggests that Rv0093c likely regulates copper metabolism indirectly by controlling SigC activity .

The functional pathway appears to involve:

  • SigC regulation of genes involved in copper uptake and homeostasis

  • Rv0093c binding to SigC under specific conditions

  • Modulation of SigC-dependent transcription in response to copper levels

Further research is needed to determine the exact mechanisms, including identification of the copper-sensing domains, characterization of the SigC regulon, and elucidation of how Rv0093c responds to changing copper concentrations .

How does Rv0093c interact with SigC and what methods can detect this interaction?

Rv0093c interacts with SigC as a specific anti-sigma factor, likely binding to and sequestering SigC to prevent its association with RNA polymerase. This interaction can be detected and characterized using multiple complementary methods:

  • Physical interaction methods:

    • Co-immunoprecipitation with antibodies against either protein

    • Bacterial two-hybrid assays to confirm direct interaction

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Microscale thermophoresis for binding under native conditions

  • Functional validation approaches:

    • Electrophoretic mobility shift assays (EMSA) to assess SigC-DNA binding in the presence/absence of Rv0093c

    • In vitro transcription assays using purified components

    • Reporter gene assays in mycobacterial systems

  • Structural characterization:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • X-ray crystallography or cryo-EM of the complex if possible

These methods together would provide comprehensive evidence for the physical and functional relationship between Rv0093c and SigC .

What is known about the structural features of Rv0093c that contribute to its function?

Based on the amino acid sequence analysis of Rv0093c, several structural features likely contribute to its function as an anti-sigma factor:

Structural FeaturePositionPredicted Function
N-terminal domain1-100Potential protein-protein interaction domain for SigC binding
Cysteine-rich region~100-150Possible metal sensing or redox-sensitive region
Hydrophobic regions151-220Potential membrane association or integration domains
C-terminal domain221-282Regulatory domain with potential phosphorylation sites

The presence of multiple hydrophobic segments suggests Rv0093c may be membrane-associated, which could be important for localizing SigC to specific cellular compartments. The cysteine residues (particularly in the CSACRA motif) might be involved in sensing oxidative stress or metal ions, potentially linking environmental signals to SigC activity regulation .

Complete structural characterization would require X-ray crystallography or NMR studies, which have not yet been reported for this protein.

How should researchers address apparent contradictions in the literature regarding Rv0093c function?

When encountering contradictory findings about Rv0093c function in the literature, researchers should implement a systematic approach to resolution:

  • Context analysis:

    • Examine experimental conditions, including mycobacterial strains, growth conditions, and stressors

    • Identify differences in protein expression systems and tags used

    • Consider temporal aspects of experiments (growth phase, induction timing)

  • Methodological evaluation:

    • Compare detection methods and their sensitivities

    • Assess data normalization approaches

    • Evaluate statistical analyses employed

  • Systematic review approach:

    • Categorize findings by experimental approach

    • Weight evidence based on methodological rigor

    • Identify patterns in contradictions that might suggest context-dependent functions

  • Resolution experiments:

    • Design studies specifically to test competing hypotheses

    • Include appropriate controls to address methodological differences

    • Collaborate with labs reporting contradictory results

This systematic approach acknowledges that apparent contradictions may represent context-dependent protein functions rather than actual contradictions .

What bioinformatic approaches can help predict Rv0093c function and interaction networks?

For comprehensive bioinformatic analysis of Rv0093c function and interaction networks:

  • Sequence-based predictions:

    • Perform multiple sequence alignment with characterized anti-sigma factors

    • Identify conserved domains and motifs using InterPro, Pfam, and SMART

    • Apply machine learning approaches trained on known anti-sigma factors

  • Structural predictions:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Perform molecular docking simulations with SigC

    • Identify potential binding sites and interaction interfaces

  • Network analysis:

    • Construct protein-protein interaction networks from existing mycobacterial datasets

    • Apply guilt-by-association approaches using co-expression data

    • Integrate transcriptomic data from SigC studies to identify potential regulated genes

  • Functional enrichment:

    • Analyze potential binding partners for enriched biological processes

    • Compare predicted functions with existing copper homeostasis pathways

    • Evaluate evolutionary conservation across mycobacterial species

These complementary approaches can generate testable hypotheses about Rv0093c function and guide experimental design for validation studies .

How can researchers determine if experimental results with Rv0093c are reproducible and reliable?

To ensure reproducibility and reliability of Rv0093c experimental results:

  • Experimental design considerations:

    • Implement randomization and blinding where possible

    • Calculate appropriate sample sizes based on power analysis

    • Pre-register experimental protocols and analysis plans

  • Technical validation steps:

    • Verify protein identity by mass spectrometry before experiments

    • Confirm activity using established functional assays

    • Validate antibody specificity with appropriate controls

  • Reproducibility assessment:

    • Perform independent replication within the same laboratory

    • Collaborate with other laboratories for external validation

    • Use different experimental approaches to confirm key findings

  • Statistical rigor:

    • Apply appropriate statistical tests based on data distribution

    • Control for multiple comparisons

    • Report effect sizes and confidence intervals, not just p-values

  • Transparent reporting:

    • Document all experimental conditions in detail

    • Share raw data through appropriate repositories

    • Report both positive and negative results

This comprehensive approach strengthens confidence in findings related to Rv0093c function and minimizes the risk of irreproducible results .

How might Rv0093c function in the context of M. tuberculosis pathogenesis and stress response?

In the context of M. tuberculosis pathogenesis and stress response, Rv0093c likely functions as a critical regulatory switch:

  • Environmental sensing mechanism:

    • Rv0093c may sense changes in copper concentrations inside macrophages

    • Its anti-sigma activity could respond to phagosomal acidification

    • The protein might integrate multiple stress signals to modulate SigC activity

  • Transcriptional reprogramming:

    • By controlling SigC availability, Rv0093c indirectly regulates expression of virulence genes

    • This regulation likely contributes to biofilm formation, which is important for persistence

    • The SigC regulon may include genes essential for survival under host immune pressure

  • Temporal regulation during infection:

    • Different infection stages may require precise modulation of SigC activity

    • Rv0093c could facilitate rapid adaptation to changing host environments

    • This dynamic regulation may be crucial for establishing persistent infection

  • Potential therapeutic target:

    • Disrupting Rv0093c-SigC interaction might attenuate bacterial adaptation

    • Compounds targeting this interaction could synergize with existing antibiotics

    • Understanding this pathway may reveal new approaches to combat latent TB

Future studies should investigate Rv0093c expression and activity in various infection models and under conditions that mimic the host environment .

What experimental approaches can determine the SigC regulon that is controlled by Rv0093c?

To comprehensively determine the SigC regulon controlled by Rv0093c, researchers should implement a multi-faceted approach:

  • Comparative transcriptomics:

    • RNA-Seq analysis comparing wild-type, ΔsigC, and ΔRv0093c strains

    • Conditional expression systems to induce/repress Rv0093c or SigC

    • Time-course experiments under various stress conditions (copper stress, oxidative stress, etc.)

  • Chromatin immunoprecipitation approaches:

    • ChIP-Seq using tagged SigC to identify direct binding sites genome-wide

    • CUT&RUN or CUT&Tag for improved resolution of binding sites

    • Compare SigC binding patterns in presence/absence of Rv0093c

  • In vitro methodologies:

    • Define SigC consensus binding sequence using SELEX or protein-binding microarrays

    • In vitro transcription assays with purified components to confirm direct regulation

    • Investigate how Rv0093c affects SigC-RNA polymerase complex formation

  • Integrative analysis:

    • Construct regulatory network models incorporating transcriptomic and ChIP data

    • Identify primary and secondary effects using temporal data

    • Validate key nodes in the network through targeted gene deletions

This comprehensive approach would elucidate both direct SigC targets and the broader regulatory network influenced by Rv0093c, providing insights into how this anti-sigma factor shapes M. tuberculosis adaptation .

How can single-case experimental designs be integrated with randomized controlled trials to advance Rv0093c research?

Integrating single-case experimental designs (SCEDs) with randomized controlled trials (RCTs) creates a powerful framework for advancing Rv0093c research:

  • Sequential research strategy:

    • Use SCEDs for initial characterization of Rv0093c functions

    • Apply findings to design focused RCTs testing specific hypotheses

    • Implement an iterative process where RCT outcomes inform new SCED investigations

  • Complementary strengths:

    • SCEDs provide detailed temporal data on Rv0093c activity under various conditions

    • RCTs offer broader validation across multiple experimental systems

    • Combined approach balances mechanistic insights with statistical power

  • Implementation methodology:

    • Begin with N-of-1 trials testing multiple conditions for Rv0093c function

    • Identify optimal experimental parameters for subsequent RCTs

    • Use SCEDs to investigate outliers or unexpected findings from RCTs

  • Integrated analysis framework:

    • Develop statistical methods combining SCED and RCT data

    • Apply Bayesian approaches to update prior distributions based on SCED results

    • Create predictive models that incorporate both individual-level and population-level data

This integrated approach is particularly valuable for Rv0093c research, where functional characterization requires both detailed mechanistic studies and broader validation across experimental systems .

What are the key considerations for developing ELISA-based detection methods for Rv0093c?

Developing effective ELISA-based detection methods for Rv0093c requires careful attention to several critical factors:

  • Antibody development strategy:

    • Generate antibodies against multiple epitopes to ensure detection

    • Validate antibody specificity against recombinant protein and M. tuberculosis lysates

    • Consider monoclonal antibodies for reproducibility in quantitative assays

  • Assay optimization parameters:

    • Determine optimal coating concentration of capture antibody (typically 1-10 μg/mL)

    • Optimize blocking conditions to minimize background (typically 1-5% BSA or casein)

    • Establish standard curves using purified recombinant Rv0093c (50-500 ng/mL range)

  • Sample preparation considerations:

    • Develop effective protein extraction methods from mycobacterial cultures

    • Optimize lysis buffers to solubilize membrane-associated Rv0093c

    • Consider pre-treatment steps for clinical samples

  • Validation requirements:

    • Determine limit of detection and quantification

    • Assess cross-reactivity with related mycobacterial proteins

    • Evaluate reproducibility across different lots of reagents

This methodical approach ensures development of reliable quantitative assays for Rv0093c detection in both research and potential diagnostic applications .

How should researchers design experiments to investigate Rv0093c-SigC interaction in response to copper stress?

To investigate the Rv0093c-SigC interaction in response to copper stress, researchers should design experiments that address both molecular mechanisms and physiological relevance:

  • Dose-response studies:

    • Expose M. tuberculosis cultures to a range of copper concentrations (0-500 μM)

    • Monitor Rv0093c-SigC interaction at defined timepoints (0, 1, 4, 24 hours)

    • Correlate interaction dynamics with transcriptional changes of SigC-dependent genes

  • Interaction characterization:

    • Perform co-immunoprecipitation under varying copper concentrations

    • Use fluorescence resonance energy transfer (FRET) to monitor interaction in real-time

    • Apply hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • Functional validation:

    • Create copper-binding site mutants in Rv0093c

    • Compare wild-type and mutant strains for growth and survival under copper stress

    • Assess biofilm formation capacity as a function of copper concentration

  • Systems approach:

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Develop computational models of the copper response network

    • Validate model predictions through targeted interventions

This comprehensive experimental design would elucidate how the Rv0093c-SigC regulatory system responds to copper stress and contributes to M. tuberculosis adaptation .

What approaches can detect contradictions in published research about Rv0093c and resolve them methodically?

To systematically detect and resolve contradictions in Rv0093c research literature:

  • Automated contradiction detection:

    • Apply natural language processing to identify conflicting claims

    • Categorize contradictions by relation types (excitatory, inhibitory, associative)

    • Compute polarity of event statements to flag potential conflicts

  • Context analysis framework:

    • Evaluate species differences in experimental systems

    • Assess temporal context variations (growth phase, induction timing)

    • Compare environmental conditions (media composition, stress factors)

  • Resolution methodology:

    • Develop standardized experimental protocols to test contradictory claims

    • Create a systematic review framework with predefined quality assessment criteria

    • Implement meta-analysis approaches for quantitative contradictions

  • Community engagement:

    • Establish collaborative platforms for researchers to discuss apparent contradictions

    • Develop shared resources for standardized materials (plasmids, antibodies, strains)

    • Implement pre-registration of experimental designs to reduce publication bias

This structured approach would help identify whether contradictions reflect genuine biological complexity or methodological differences, ultimately advancing our understanding of Rv0093c function .

What are the most promising approaches for targeting the Rv0093c-SigC interaction for tuberculosis treatment?

The Rv0093c-SigC regulatory system presents several promising therapeutic targeting approaches:

  • Small molecule inhibitor development:

    • Screen for compounds that disrupt Rv0093c-SigC protein-protein interaction

    • Design peptidomimetics based on interaction interface mapping

    • Develop allosteric modulators that lock Rv0093c in SigC-binding conformation

  • Targeted degradation strategies:

    • Create PROTAC-like molecules that recruit mycobacterial proteases to Rv0093c

    • Design antisense oligonucleotides targeting Rv0093c mRNA

    • Develop CRISPRi approaches for conditional knockdown

  • Combination therapy approaches:

    • Identify synergistic effects between Rv0093c inhibitors and existing antibiotics

    • Target multiple sigma factor regulatory systems simultaneously

    • Develop dual-action compounds affecting both Rv0093c and copper homeostasis

  • Host-directed therapy integration:

    • Modulate host copper homeostasis to enhance Rv0093c-targeting therapies

    • Combine with immunomodulatory approaches that activate macrophages

    • Develop nanoparticle delivery systems for targeted drug delivery

These approaches would exploit the regulatory role of Rv0093c in M. tuberculosis adaptation and potentially overcome issues with existing treatments such as drug resistance and bacterial persistence .

How might structural biology approaches advance our understanding of Rv0093c function?

Advanced structural biology approaches would significantly enhance our understanding of Rv0093c function through:

  • High-resolution structure determination:

    • X-ray crystallography of Rv0093c alone and in complex with SigC

    • Cryo-electron microscopy to capture dynamic states

    • NMR spectroscopy to identify flexible regions and binding interfaces

  • Dynamic structural studies:

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Single-molecule FRET to observe real-time conformational dynamics

    • Molecular dynamics simulations to predict conformational responses to copper

  • Structure-guided functional analysis:

    • Rational design of point mutations based on structural data

    • Identification of potential copper-binding sites

    • Engineering of protein variants with altered regulatory properties

  • Integrative structural biology:

    • Combine multiple structural techniques for comprehensive characterization

    • Correlate structural features with evolutionary conservation

    • Develop structure-based models of the regulatory mechanism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.