Recombinant Uncharacterized protein Rv0497/MT0517 (Rv0497, MT0517)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us; we will prioritize its inclusion in the manufacturing process.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Target Names
Rv0497, MT0517
Target Protein Sequence
MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAITVAELTGEIPIIRDD HHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTRTVYWSQPEPRWPKSPP QDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEHYPDLWVDVLDTEVGEAE AETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALDVVPTLWRGALVVLQSILA VAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVRKTEDIASTLIAVAVGALIT LGPLALLQSG
Uniprot No.

Q&A

What is the genetic context of Rv0497/MT0517 in Mycobacterium tuberculosis?

Rv0497/MT0517 is a gene coding for an uncharacterized transmembrane protein in the Mycobacterium tuberculosis genome. The genomic context analysis reveals it is located within a region associated with cell wall maintenance and potentially involved in virulence mechanisms. To properly characterize this genetic context, researchers should:

  • Perform comparative genomic analysis across multiple Mycobacterium strains

  • Analyze upstream and downstream genetic elements including promoters and terminators

  • Examine conservation patterns across mycobacterial species

  • Investigate potential operon structures containing this gene

Current research indicates this protein may be part of a larger functional network of transmembrane proteins involved in mycobacterial cell envelope maintenance. Context analysis should include examination of neighboring genes and their expression patterns under various stress conditions1.

What expression systems are most suitable for Rv0497/MT0517 production?

The selection of an appropriate expression system for Rv0497/MT0517 depends on several factors including downstream applications and protein modification requirements. Based on available data, several expression systems have been successfully employed:

Expression SystemAdvantagesLimitationsTypical YieldPurity
E. coliRapid growth, high yield, low costPotential improper folding of membrane proteins5-10 mg/L≥85%
YeastPost-translational modificationsLonger production time2-5 mg/L≥85%
BaculovirusComplex folding capacityHigher cost, technical complexity3-8 mg/L≥85%
Mammalian CellNative-like modificationsHighest cost, lowest yield1-3 mg/L≥85%
Cell-Free ExpressionRapid, membrane protein compatibilityLimited scaleVariable≥85%

When working with this transmembrane protein, researchers should consider:

  • Codon optimization for the selected expression system

  • Addition of solubility tags (such as MBP or SUMO) to improve yield

  • Inclusion of appropriate detergents during purification

  • Careful optimization of induction conditions to prevent inclusion body formation

What are the predicted structural features of Rv0497/MT0517?

As an uncharacterized protein, Rv0497/MT0517's structure has been predicted through bioinformatic approaches rather than experimentally determined. Computational analysis suggests:

  • The protein contains approximately 2-3 transmembrane domains

  • Secondary structure predictions indicate a predominantly alpha-helical structure within the transmembrane regions

  • Potential N-terminal cytoplasmic domain with disordered regions

  • Conserved motifs that suggest possible ion channel or transporter functionality

To further analyze structural features, researchers should employ:

  • Hydropathy plot analysis to confirm transmembrane regions

  • Multiple sequence alignment with homologous proteins from related species

  • Advanced structure prediction algorithms like AlphaFold2 or RoseTTAFold

  • Circular dichroism spectroscopy to experimentally validate secondary structure predictions

The presence of transmembrane domains makes this protein challenging for traditional structural biology approaches, suggesting that a combination of computational and experimental techniques will be necessary for comprehensive characterization .

What protein-protein interaction networks might involve Rv0497/MT0517?

Understanding the interaction partners of Rv0497/MT0517 is crucial for elucidating its functional role in Mycobacterium tuberculosis. Several methodological approaches can be employed to map these interactions:

  • Bacterial Two-Hybrid Screening: Particularly effective for membrane proteins when using split-ubiquitin systems

  • Co-immunoprecipitation: Requires development of specific antibodies against Rv0497/MT0517

  • Proximity-Dependent Biotin Identification (BioID): Can identify transient or weak interactions in the native environment

  • Cross-linking Mass Spectrometry: Useful for capturing direct physical interactions

Preliminary research suggests potential interactions with:

  • Cell wall biosynthesis machinery components

  • Other uncharacterized membrane proteins in the same genomic vicinity

  • Stress response proteins activated during host infection

When analyzing interaction data, researchers should be careful to distinguish between direct physical interactions and functional associations. Validation through multiple independent techniques is essential, particularly when working with an uncharacterized transmembrane protein that presents technical challenges for interaction studies1.

How might post-translational modifications affect Rv0497/MT0517 function?

Post-translational modifications (PTMs) can significantly impact protein function, particularly for bacterial proteins involved in pathogenesis. For Rv0497/MT0517, several potential PTMs warrant investigation:

Modification TypePrediction ToolsDetection MethodsPotential Functional Impact
PhosphorylationNetPhos, GPSPhosphoproteomics, Phos-tag SDS-PAGESignal transduction, activity regulation
GlycosylationNetOGlyc, GlycoMineGlycoproteomics, Lectin blottingProtein stability, host-pathogen interactions
LipidationGPS-Lipid, PreLipoMetabolic labeling, Mass spectrometryMembrane anchoring, localization
Proteolytic ProcessingSignalP, PROSPERN-terminal sequencing, Western blotActivation, localization change

To systematically investigate PTMs in Rv0497/MT0517:

  • Express the protein in different systems (E. coli, mycobacterial expression) to compare modification patterns

  • Perform targeted mass spectrometry analysis focusing on predicted modification sites

  • Create site-directed mutants of predicted modification sites to assess functional consequences

  • Compare modification patterns under different growth conditions or stress responses

The transmembrane nature of this protein adds complexity to PTM analysis, requiring careful optimization of extraction and enrichment techniques to maintain protein integrity while enabling comprehensive modification mapping1 .

What role might Rv0497/MT0517 play in Mycobacterium tuberculosis virulence?

As an uncharacterized protein, establishing Rv0497/MT0517's potential role in virulence requires a multi-faceted research approach:

  • Gene Knockout Studies:

    • Create clean deletion mutants using specialized mycobacterial genetic tools

    • Evaluate growth phenotypes in various stress conditions mimicking the host environment

    • Assess survival within macrophage infection models

    • Measure virulence in animal models (e.g., mouse infection studies)

  • Transcriptional Analysis:

    • Examine expression patterns during different infection stages

    • Analyze regulatory networks controlling Rv0497/MT0517 expression

    • Compare expression in virulent vs. attenuated strains

  • Functional Genomics Approaches:

    • Transposon mutagenesis to identify genetic interactions

    • CRISPRi for conditional knockdown to assess essentiality in different conditions

    • Suppressor mutation analysis to identify functional pathways

Current research suggests transmembrane proteins like Rv0497/MT0517 often contribute to mycobacterial virulence through mechanisms including:

  • Maintenance of cell wall integrity during host-induced stress

  • Transport of essential nutrients or export of virulence factors

  • Sensing environmental changes within the host

  • Evasion of host immune responses

Researchers should correlate any phenotypic changes in knockout strains with specific virulence mechanisms and validate findings across multiple experimental systems to establish causality rather than correlation1.

What are the optimal conditions for solubilizing and purifying Rv0497/MT0517?

Membrane protein purification presents unique challenges that require careful optimization. For Rv0497/MT0517, consider the following methodological approach:

  • Extraction Optimization:

Detergent ClassExamplesCMC (mM)AdvantagesLimitations
Non-ionicDDM, Triton X-1000.17, 0.2-0.9Mild, preserves activityLower efficiency
ZwitterionicCHAPS, Fos-Choline8-10, 1.5Higher extraction efficiencyMay destabilize structure
Lipid-likeDigitonin, MSP nanodiscs0.5, N/ANear-native environmentExpensive, complex
  • Purification Strategy:

    • Initial capture: Nickel-IMAC (using His-tagged constructs)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Quality control: SDS-PAGE, Western blot, mass spectrometry

  • Critical Optimization Parameters:

    • Detergent concentration (typically 2-5× CMC for solubilization, 1-2× CMC for purification)

    • Buffer composition (pH 7.5-8.0, 150-300 mM NaCl typically optimal)

    • Temperature (conduct purification at 4°C)

    • Addition of stabilizers (glycerol 10%, cholesteryl hemisuccinate)

    • Protease inhibitor cocktail selection

  • Yield Enhancement Strategies:

    • Optimize expression conditions (temperature, induction time)

    • Consider fusion partners that enhance membrane protein expression

    • Implement on-column refolding for inclusion body recovery

    • Evaluate detergent screening to identify optimal solubilization conditions

For functional studies, consider reconstitution into proteoliposomes or nanodiscs after purification to provide a lipid environment that may be essential for activity. Typical yields of 2-5 mg pure protein per liter of culture can be expected when using optimized protocols .

What approaches are most effective for functional characterization of Rv0497/MT0517?

Given the uncharacterized nature of Rv0497/MT0517, a systematic approach to functional characterization is necessary:

  • Transport Function Assessment:

    • Liposome reconstitution with fluorescent substrates

    • Membrane potential measurements using voltage-sensitive dyes

    • Radiolabeled substrate uptake assays

    • Patch-clamp electrophysiology for channel activity

  • Enzymatic Activity Screening:

    • Generic assays for common membrane protein functions (ATPase, phosphatase)

    • Substrate screening panels based on predicted functions

    • Activity coupling assays using reporter systems

    • Differential scanning fluorimetry with potential ligands/substrates

  • Structural Dynamics Studies:

    • Hydrogen-deuterium exchange mass spectrometry

    • Site-directed spin labeling with EPR spectroscopy

    • Single-molecule FRET to observe conformational changes

    • Limited proteolysis coupled with mass spectrometry

  • In Vivo Function Assessment:

    • Complementation studies in knockout strains

    • Phenotypic microarrays to identify growth condition dependencies

    • Metabolomic profiling to identify pathway disruptions

    • Stress response assays under various environmental challenges

A decision tree approach is recommended, where initial broad screening narrows down potential functions, followed by focused validation experiments. For transmembrane proteins, establishing the correct membrane environment is critical for observing native function in in vitro assays1 .

What are the best approaches for generating antibodies against Rv0497/MT0517?

Developing specific antibodies against membrane proteins like Rv0497/MT0517 presents unique challenges requiring specialized approaches:

  • Antigen Design Strategies:

Antigen TypeAdvantagesLimitationsSuccess Rate
Full-length proteinComplete epitope representationDifficult to produce, low solubility30-40%
Extracellular domainsBetter solubility, accessibilityLimited epitope selection50-60%
Synthetic peptidesHigh purity, specific targetingMay not represent native structure40-70%
DNA immunizationNative folding, post-translational modificationsVariable expression levels30-50%
  • Immunization Protocol Optimization:

    • Use multiple adjuvants (e.g., Freund's, alum, RIBI)

    • Employ extended immunization schedules (12-16 weeks)

    • Consider multiple host species (rabbit, chicken, llama)

    • Implement prime-boost strategies with different antigen formats

  • Antibody Selection and Validation:

    • Screen using multiple techniques (ELISA, Western blot, immunoprecipitation)

    • Validate specificity against knockout strains

    • Confirm native protein recognition in cellular fractions

    • Assess cross-reactivity with related mycobacterial proteins

  • Alternative Approaches When Traditional Methods Fail:

    • Phage display antibody libraries

    • Single B-cell sorting and antibody cloning

    • Camelid nanobodies for better access to membrane protein epitopes

    • Synthetic antibody mimetics (DARPins, Affibodies)

For Rv0497/MT0517, targeting the predicted extracellular loops and N/C-terminal domains offers the highest probability of success. When designing peptide antigens, ensure they represent surface-exposed regions rather than transmembrane domains, which are typically poorly immunogenic and may generate antibodies that fail to recognize the native protein1.

How should discrepancies in Rv0497/MT0517 functional predictions be resolved?

When working with uncharacterized proteins like Rv0497/MT0517, researchers often encounter conflicting functional predictions from different computational methods. A systematic approach to resolving these discrepancies includes:

  • Hierarchical Assessment of Prediction Methods:

Prediction TypeMethodsReliability MetricsIntegration Approach
Sequence-basedBLAST, HMM profilesE-values, coverageConsensus from multiple tools
Structure-basedThreading, homology modelingRMSD, TM-scoreWeighting by model quality
Systems-basedGene neighborhood, co-expressionP-values, correlation coefficientsNetwork analysis integration
EvolutionaryPhylogenetic profiling, evolutionary rateConservation scores, dN/dS ratiosEvolutionary constraint analysis
  • Experimental Validation Hierarchy:

    • Begin with highest-confidence predictions across multiple methods

    • Design experiments that can distinguish between competing hypotheses

    • Implement parallel validation approaches addressing different aspects

    • Develop quantitative metrics for validating predictions

  • Integrative Data Analysis Approach:

    • Apply Bayesian integration of multiple prediction scores

    • Implement machine learning to identify patterns across prediction methods

    • Use structural information to filter biologically implausible predictions

    • Consider context-specific functionality (e.g., during infection vs. dormancy)

  • Dealing with Novel Functions:

    • Recognize limitations of homology-based predictions

    • Design unbiased screening approaches when predictions fail

    • Consider analogous functions in distantly related proteins

    • Explore strain-specific adaptations that may indicate specialized functions

For Rv0497/MT0517, researchers have observed discrepancies between predictions suggesting transporter activity versus structural roles in cell wall maintenance. Resolving these requires targeted experiments that can specifically test each hypothesis, rather than relying solely on additional computational analysis1.

What statistical approaches are appropriate for analyzing Rv0497/MT0517 knockout phenotype data?

  • Experimental Design Considerations:

    • Include biological replicates (n≥3) for robust statistical power

    • Implement technical replicates to assess methodological variation

    • Include appropriate controls (wild-type, complemented mutant, unrelated gene knockout)

    • Account for batch effects in multi-day experiments

  • Statistical Analysis Framework:

Data TypeAppropriate TestsAssumptionsPost-hoc Analysis
Growth curvesRepeated measures ANOVA, non-linear regressionNormality, sphericityGrowth parameter comparison
Survival assaysLog-rank test, Cox proportional hazardsProportional hazardsSurvival curve comparison
Gene expressionDESeq2, EdgeR, LIMMANegative binomial distributionPathway enrichment analysis
MetabolomicsOPLS-DA, Random ForestVariable independenceMetabolite set enrichment
  • Multiple Testing Correction:

    • Apply Bonferroni correction for small-scale targeted experiments

    • Use False Discovery Rate (FDR) approaches for high-dimensional data

    • Consider Family-wise Error Rate control for confirmatory studies

    • Report both raw and adjusted p-values for transparency

  • Effect Size Reporting:

    • Calculate and report Cohen's d, fold change, or hazard ratios

    • Provide confidence intervals for all effect size estimates

    • Consider biological significance beyond statistical significance

    • Implement meta-analysis when comparing across experimental systems

  • Advanced Considerations:

    • Account for time-dependent effects in infection models

    • Consider competitive index analysis for mixed infection experiments

    • Implement longitudinal data analysis for time-series experiments

    • Use multivariate approaches for complex phenotypic datasets

When analyzing Rv0497/MT0517 knockout data, particular attention should be paid to subtle phenotypes that may only manifest under specific stress conditions, requiring robust statistical approaches to detect small but biologically meaningful differences1 .

How can researchers integrate structural and functional data to build a comprehensive model of Rv0497/MT0517?

Creating an integrated understanding of Rv0497/MT0517 requires synthesizing diverse experimental data types into a coherent functional model:

  • Data Integration Framework:

Data TypeExperimental MethodsIntegration ApproachModel Contribution
Primary sequenceComputational analysisMotif identification, domain mappingFunctional element prediction
Secondary structureCD spectroscopy, prediction algorithmsTopology modelingTransmembrane arrangement
Tertiary structureCryo-EM, X-ray crystallography, computational modelingStructure visualization3D conformation
DynamicsMD simulations, HDX-MSMotion pathway analysisConformational changes
InteractionsCo-IP, crosslinking MS, BioIDInteraction network mappingProtein complexes, pathways
FunctionalActivity assays, phenotypic studiesFunction assignmentBiological role definition
  • Multi-scale Modeling Approach:

    • Begin with atomic-level structural features

    • Expand to protein-protein interaction networks

    • Incorporate into pathway/systems models

    • Connect to organism-level phenotypes

  • Integrative Visualization Methods:

    • Structural mapping of functional data (e.g., activity-affecting mutations)

    • Network visualization incorporating structural information

    • Dynamic models showing conformational changes linked to function

    • Multi-level models connecting molecular features to cellular phenotypes

  • Model Validation Strategies:

    • Design experiments explicitly testing model predictions

    • Identify critical nodes in the model for targeted perturbation

    • Develop quantitative metrics for model assessment

    • Implement iterative refinement based on new experimental data

For membrane proteins like Rv0497/MT0517, special attention should be paid to the lipid environment and its impact on structure and function. Researchers should consider developing "living models" that evolve as new data becomes available, rather than static representations that quickly become outdated as characterization progresses1 .

What are the most promising future research directions for Rv0497/MT0517 characterization?

Based on current knowledge and technological capabilities, several high-priority research directions emerge for comprehensive characterization of Rv0497/MT0517:

  • Structural Biology Approaches:

    • Apply advances in membrane protein cryo-EM for structure determination

    • Implement integrated structural approaches combining crystallography with spectroscopic methods

    • Develop structural models in native-like membrane environments

  • Systems-Level Investigation:

    • Conduct genome-wide genetic interaction screens (CRISPR interference)

    • Map condition-specific essentiality profiles

    • Integrate with mycobacterial virulence networks

  • Translational Research Potential:

    • Assess as potential drug target through vulnerability studies

    • Evaluate immunogenicity for vaccine development

    • Investigate diagnostic potential for TB detection

  • Technical Development Needs:

    • Improved methods for mycobacterial membrane protein expression

    • Enhanced functional assays for transporters/channels

    • Better computational tools for uncharacterized protein function prediction

Research programs should prioritize addressing the fundamental gap in understanding: establishing the basic biological function of Rv0497/MT0517 before pursuing more specialized applications. Given the challenges inherent in working with mycobacterial membrane proteins, coordinated multi-lab efforts will likely prove more successful than isolated approaches1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.