Recombinant Uncharacterized protein Rv0874c/MT0897 (Rv0874c, MT0897)

Shipped with Ice Packs
In Stock

Description

General Information

Rv0874c/MT0897 is an uncharacterized protein from Mycobacterium tuberculosis . Creative BioMart offers Rv0874c/MT0897 proteins for life science research and states that all products are rigorously tested .

Table 1: Recombinant Rv0874c/MT0897 Product Details

Cat.#Product NameSource (Host)SpeciesTagProtein LengthPrice
RFL24795HFRecombinant Full Length Uncharacterized Protein Rv0874C/Mt0897 (Rv0874C, Mt0897) Protein, His-TaggedE. coliHumanHisFull Length (1-386)N/A

Function and Pathways

The uncharacterized protein Rv0874c/MT0897 is involved in several pathways and has different roles, and it has several biochemical functions . Rv0874c/MT0897 interacts directly with proteins and molecules, and these interactions have been detected through methods like yeast two-hybrid assays, co-IP, and pull-down assays .

Rv0792c as a HutC Homolog

Rv0792c is a HutC homolog from Mycobacterium tuberculosis . A strain of M. tuberculosis with a Rv0792c mutant was compromised for survival upon exposure to oxidative stress and infection in guinea pigs, when compared to the parental strain . RNA sequencing analysis has shown that Rv0792c regulates the expression of genes involved in stress adaptation and virulence of M. tuberculosis .

Rv0792c and GntR Transcription Factors

Rv0792c belongs to the HutC subfamily of GntR transcription factors . M. tuberculosis has seven GntR homologs (Rv0043c, Rv0165c, Rv0494, Rv0586, Rv0792c, Rv1152, and Rv3060c), and multiple-sequence alignment revealed that these share almost identical residues in the DNA binding amino-terminal region . Rv0792c shares an identity of ~30% with other HutC homologs . Residues Arg49 and Gly80 of Rv0792c are important for DNA binding .

Table 2: Binding Affinity of Rv0792c Mutants

ProteinKd Value (nM)
Wild-type~51
Rv0792c R49A~74
Rv0792c G80D~120

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Target Names
Rv0874c, MT0897
Target Protein Sequence
MRIGVGVCTTPDARQAAVEAAGQARDELAGEAPSLAVLLGSRAHTDRAADVLSAVLQMID PPALVGCIAQAIVAGRHEIEDEPAVVVWLASGLAAETFQLDFVRTGSGALITGYRFDRTA RDLHLLLPDPYTFPSNLLIEHPNTDLPGTAVVGGVVSGGRRRGDTRLFRDHDVLTSGVVG VRLPGMRGVPVVSQGCRPIGYPYIVTGADGILITELGGRPPLQRLREIVEGLSPDERALV SHGLQIGIVVDEHLAAPGQGDFVIRGLLGADPSTGSIEIDEVVQVGATMQFQVRDAAGAD KDLRLTVERAAARLPGRAAGALLFTCNGRGRRMFGVADHDASTIEELLGGIPLAGFFAAG EIGPIAGRNALHGFTASMALFVDDME
Uniprot No.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.