Recombinant Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Uncharacterized protein Rv0885/MT0908 is a 340-amino-acid protein encoded by the Rv0885/MT0908 gene in Mycobacterium tuberculosis (UniProt ID: P0A5D5). Its biological function remains uncharacterized, but it is studied for its potential role in tuberculosis pathogenesis and vaccine development .

Expression and Purification:

  • Produced in E. coli with codon optimization for high-yield expression .

  • Purified via affinity chromatography using the His tag .

  • Alternative expression systems (yeast, mammalian cells) are available for specific research needs .

Key Uses:

  • Vaccine Development: Investigated as a potential antigen for tuberculosis vaccines due to its immunogenic properties .

  • Diagnostic Tools: Utilized in ELISA kits for tuberculosis serology studies .

  • Structural Biology: Serves as a substrate for crystallography and protein interaction studies .

Experimental Notes:

  • Non-pathogenic in recombinant form but requires biosafety level 2 (BSL-2) handling .

  • Not for human consumption or clinical use .

Challenges and Considerations

  • Drug Resistance: M. tuberculosis strains expressing Rv0885/MT0908 may contribute to multidrug resistance mechanisms, necessitating further functional studies .

  • Storage Sensitivity: Lyophilized form is prone to degradation if reconstituted improperly .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Target Names
Rv0885, MT0908
Target Protein Sequence
MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA
Uniprot No.

Q&A

What is the basic genomic and proteomic structure of Rv0885/MT0908?

Rv0885 is a possible transmembrane protein encoded in the Mycobacterium tuberculosis genome. Based on current characterization, the protein has the following structural properties:

FeatureDetails
ProductPossible transmembrane protein
Feature TypeCDS (Coding Sequence)
Start Position982762
End Position983784
StrandPositive (+)
Length1,023 base pairs
Amino Acid Length340 amino acids
Transcription FactorFALSE

Additionally, the gene has a BASS Score of -0.313 with a Primary TSS (Transcription Start Site) at position 982724, and a re-annotated start at position 982801 compared to the Tuberculist annotated start at position 982762 .

The methodological approach to determining these properties typically involves whole genome sequencing followed by computational prediction of open reading frames, promoter regions, and protein-coding sequences using bioinformatics tools such as BLAST, InterPro, and specialized mycobacterial genome databases.

What cellular functions is Rv0885/MT0908 predicted to be involved in?

Based on bioinformatic predictions and co-expression data, Rv0885 is likely involved in several cellular processes:

  • Transport functions: The protein shows enrichment for GO terms related to transport and establishment of localization.

  • Membrane activities: Specifically associated with arsenite transmembrane transporter activity and anion transmembrane transporter activity.

  • Cholesterol utilization: The gene has been found to be important for growth on cholesterol as a carbon source, suggesting a role in lipid metabolism or transport .

To investigate these predicted functions, researchers typically employ techniques such as gene knockout studies, transcriptional profiling under various growth conditions, and protein localization studies using fluorescent tags or immunological methods.

How is Rv0885/MT0908 genetically regulated in Mycobacterium tuberculosis?

Rv0885 demonstrates specific co-regulation patterns that may indicate its functional importance:

The protein is predicted to be co-regulated in two distinct modules:

  • Bicluster_0478 with residual value of 0.49

  • Bicluster_0590 with residual value of 0.54

This regulation appears to be mediated by de-novo identified cis-regulatory motifs with the following statistical significance:

  • For bicluster_0478: e-values of 0.00 and 0.09

  • For bicluster_0590: e-values of 0.00 and 0.00

These co-regulation patterns suggest that Rv0885 functions within specific regulatory networks in M. tuberculosis. To experimentally validate these predictions, researchers would typically use methods such as chromatin immunoprecipitation (ChIP), electrophoretic mobility shift assays (EMSA), or reporter gene assays to identify transcription factors that bind to the predicted regulatory motifs.

How does the structure of Rv0885/MT0908 compare with other characterized transmembrane proteins in mycobacteria?

While specific structural data for Rv0885 is limited, researchers can apply comparative genomic and structural biology approaches to understand this protein:

  • Homology modeling: Using the 340 amino acid sequence of Rv0885, researchers can construct potential structural models based on homologous proteins with known structures. This would typically involve tools like SWISS-MODEL, Phyre2, or AlphaFold.

  • Transmembrane domain prediction: Programs such as TMHMM, HMMTOP, or Phobius can be used to identify the likely membrane-spanning regions of the protein.

  • Comparative analysis: The structure can be compared with other mycobacterial transmembrane proteins to identify conserved domains or motifs that might indicate function.

A rigorous approach would include:

  • Multiple sequence alignment with homologous proteins

  • Phylogenetic analysis to identify evolutionary relationships

  • Structural prediction and validation using multiple algorithms

  • Experimental verification through techniques such as circular dichroism, X-ray crystallography, or cryo-electron microscopy, depending on the feasibility of protein purification

How might Rv0885/MT0908 contribute to M. tuberculosis pathogenicity based on its predicted functions?

Although direct evidence linking Rv0885 to pathogenicity is not provided in the search results, we can draw insights from related transmembrane proteins in mycobacteria:

The association of Rv0885 with transport functions, particularly arsenite and anion transport, suggests potential roles in:

  • Ion homeostasis: Maintenance of intracellular ion concentrations critical for survival in the host environment.

  • Detoxification: Efflux of host-derived antimicrobial compounds or environmental toxins.

  • Nutrient acquisition: Transport of essential nutrients across the mycobacterial cell envelope, which is particularly relevant given its association with cholesterol utilization .

To investigate these potential pathogenicity-related functions, researchers would typically employ:

  • Generation of knockout mutants and assessment of their virulence in cellular and animal infection models

  • Transcriptional profiling of wild-type vs. mutant strains during infection

  • Protein localization studies during different stages of infection

  • Biochemical characterization of transport function using membrane vesicles or reconstituted systems

What experimental contradictions exist in the current research on Rv0885/MT0908, and how might they be resolved?

Current literature on Rv0885 presents several areas of uncertainty:

  • Functional annotation: While annotated as a "possible transmembrane protein," the specific transport substrates and mechanism remain undefined. This contrasts with the specific GO term associations for arsenite and anion transport .

  • Start codon discrepancy: The search results indicate a discrepancy between the Tuberculist annotated start (982762) and a re-annotated start (982801), suggesting uncertainty about the precise N-terminal sequence of the protein .

To resolve these contradictions, researchers should consider:

  • Experimental validation of the translational start site using techniques such as:

    • N-terminal protein sequencing

    • Ribosome profiling

    • Targeted mutagenesis of potential start codons followed by complementation studies

  • Functional characterization through:

    • Substrate transport assays using radiolabeled or fluorescent compounds

    • Membrane potential measurements in wild-type vs. knockout strains

    • Protein-protein interaction studies to identify functional complexes

  • Comparative genomics across mycobacterial species to identify conservation patterns that might indicate functional importance

What approaches are most effective for expressing and purifying recombinant Rv0885/MT0908 protein?

Expressing and purifying transmembrane proteins like Rv0885 presents significant challenges. Based on research methodologies for similar mycobacterial proteins, researchers should consider:

  • Expression Systems:

    • E. coli-based systems: BL21(DE3) or C41/C43 strains specifically designed for membrane protein expression

    • Mycobacterial expression systems: M. smegmatis may provide a more native-like environment for proper folding

    • Cell-free expression systems: These can be advantageous for toxic or difficult-to-express proteins

  • Expression Optimization:

    • Lower induction temperatures (16-20°C)

    • Reduced inducer concentrations

    • Co-expression with chaperones

    • Use of solubility-enhancing fusion tags (MBP, SUMO, Trx)

  • Purification Strategy:

    • Detergent screening (DDM, LDAO, FC-12) for solubilization

    • Affinity chromatography (typically His-tag or other fusion tags)

    • Size exclusion chromatography for final polishing

A systematic experimental design might include:

Experimental VariableOptions to TestEvaluation Criteria
Expression HostE. coli BL21(DE3), C41, C43, M. smegmatis mc²155Protein yield, solubility
Growth Temperature37°C, 30°C, 18°CProtein folding, aggregation
Induction Time2h, 4h, overnightYield vs. degradation
Detergent for SolubilizationDDM, LDAO, FC-12, OGExtraction efficiency, protein stability
Purification MethodIMAC, ion exchange, SECPurity, yield, activity

Successful purification should be verified by SDS-PAGE, Western blotting, and functional assays appropriate to the predicted transport function.

What methodologies can be employed to study the potential role of Rv0885/MT0908 in cholesterol utilization?

Given the association between Rv0885 and growth on cholesterol , several experimental approaches can be employed:

  • Genetic Approaches:

    • Construction of knockout mutants (Δrv0885) and complemented strains

    • Conditional expression systems to regulate Rv0885 levels

    • Site-directed mutagenesis of key predicted functional residues

  • Growth and Metabolic Studies:

    • Comparative growth curves in media with cholesterol vs. other carbon sources

    • Radioisotope labeling to track cholesterol uptake and metabolism

    • Metabolomic profiling to identify pathway intermediates

  • Protein Interaction Studies:

    • Bacterial two-hybrid assays to identify protein partners

    • Co-immunoprecipitation with known cholesterol metabolism proteins

    • Proximity labeling methods (BioID, APEX) to identify proximal proteins in vivo

Sample experimental design for growth studies:

Carbon SourceWild-type GrowthΔrv0885 GrowthComplemented Strain Growth
Glycerol (0.2%)+++++++++
Glucose (0.2%)+++++++++
Cholesterol (0.01%)++++/-+++
Cholesterol (0.05%)++++/-+++
No carbon source+++

Data should be collected at multiple time points (e.g., days 0, 3, 7, 14, 21) and analyzed for statistical significance using appropriate methods such as two-way ANOVA with Tukey's post-hoc test.

How can researchers effectively design experiments to study the co-regulation of Rv0885/MT0908 with other genes in its regulatory modules?

To investigate the co-regulation patterns identified in biclusters 0478 and 0590 , researchers should employ a multi-faceted approach:

  • Transcriptional Analysis:

    • RNA-Seq under various growth conditions relevant to M. tuberculosis pathogenesis

    • Quantitative RT-PCR targeting Rv0885 and other genes in the identified biclusters

    • Single-cell RNA-Seq to identify population heterogeneity in expression patterns

  • Promoter Analysis:

    • Reporter gene assays using the Rv0885 promoter region

    • Mutational analysis of the identified cis-regulatory motifs

    • ChIP-Seq to identify transcription factors binding to these motifs

  • Network Analysis:

    • Construction of gene regulatory networks using computational tools

    • Validation of key network hubs through targeted experiments

    • Perturbation studies using CRISPR interference or overexpression

Sample experimental design for transcriptional co-regulation:

ConditionRv0885 ExpressionGene X from Bicluster 0478Gene Y from Bicluster 0590
Log phase growth1.0 (baseline)1.0 (baseline)1.0 (baseline)
Stationary phase2.3 ± 0.31.9 ± 0.22.5 ± 0.4
Hypoxia3.8 ± 0.44.2 ± 0.53.7 ± 0.3
Low pH2.1 ± 0.22.5 ± 0.32.0 ± 0.3
Nutrient starvation4.5 ± 0.54.8 ± 0.64.3 ± 0.4

Data could be visualized using heat maps and hierarchical clustering to identify patterns of co-regulation. Statistical significance should be assessed using appropriate methods such as Pearson correlation coefficients and multiple testing correction.

How should researchers interpret the bioinformatic predictions of transmembrane domains in Rv0885/MT0908?

Transmembrane domain predictions are essential for understanding the topology and potential function of Rv0885. Researchers should approach these predictions with the following analytical framework:

  • Multiple Algorithm Comparison:

    • Use diverse prediction tools (TMHMM, HMMTOP, Phobius, MEMSAT) to generate consensus predictions

    • Identify regions of agreement and disagreement between algorithms

    • Assign confidence scores based on consensus

  • Topological Model Development:

    • Predict the number of transmembrane helices and their orientation

    • Identify potential extracellular, intracellular, and membrane-spanning regions

    • Map conserved residues onto the topological model

  • Functional Interpretation:

    • Align predicted transmembrane regions with known functional motifs in transporters

    • Identify potential substrate binding sites or channel-forming regions

    • Correlate structural predictions with the enriched GO terms (arsenite/anion transport)

Sample data representation:

Prediction AlgorithmNumber of TM HelicesN-terminal LocationPotential Channel Residues
TMHMM8CytoplasmicH120, D156, R203
HMMTOP7CytoplasmicH120, D156, R203
Phobius8CytoplasmicH120, D156, R203, Y245
MEMSAT8CytoplasmicH120, D156, R203, Y245
Consensus8CytoplasmicH120, D156, R203

Validation of these predictions might include experimental approaches such as cysteine scanning mutagenesis, protease accessibility assays, or epitope insertion followed by antibody binding studies.

What statistical approaches are most appropriate for analyzing growth phenotypes in Rv0885/MT0908 mutant studies?

When conducting growth studies with Rv0885 mutants, particularly in relation to cholesterol utilization, appropriate statistical analyses are crucial:

  • Growth Curve Analysis:

    • Parametric modeling using logistic, Gompertz, or Baranyi growth models

    • Extraction of key parameters (lag phase, maximum growth rate, carrying capacity)

    • Comparison between wild-type, mutant, and complemented strains using ANOVA or mixed-effects models

  • Time-to-event Analysis:

    • Kaplan-Meier curves for time to reach specific optical density thresholds

    • Log-rank tests for comparing growth kinetics between strains

    • Cox proportional hazards models for multivariable analysis

  • Multi-condition Comparisons:

    • Factorial design analysis using two-way or three-way ANOVA

    • Post-hoc tests with appropriate multiple testing correction

    • Interaction analyses to identify condition-specific effects

Sample statistical analysis approach:

Analysis StepMethodSoftwareParameters to Report
Data transformationLog transformation of CFU/OD valuesR (dplyr)Transformation equation
Growth parameter extractionGompertz model fittingR (growthcurver)μmax, λ, A
Statistical comparisonMixed-effects ANOVAR (lme4)F-statistic, degrees of freedom, p-value
Multiple testing correctionBenjamini-HochbergR (stats)Adjusted p-values, FDR
Post-hoc testingTukey's HSDR (multcomp)Mean differences, 95% CI, p-values
Visualizationggplot2 growth curves with error bandsR (ggplot2)Mean values, standard error ranges

Researchers should report both the statistical significance (p-values) and the biological significance (effect sizes) to provide a complete picture of the experimental results.

How can researchers integrate transcriptomic, proteomic, and functional data to build a comprehensive model of Rv0885/MT0908 function?

Integrating multiple data types is essential for developing a holistic understanding of Rv0885 function:

  • Data Integration Framework:

    • Correlation analysis between transcriptomic and proteomic data

    • Network analysis to identify functional modules

    • Bayesian approaches to integrate diverse data types with different confidence levels

  • Multi-omics Visualization:

    • Integrated heat maps showing expression across conditions

    • Network diagrams highlighting protein-protein interactions

    • Pathway maps overlaid with expression data

  • Functional Validation:

    • Targeted experiments to test hypotheses generated from integrated analysis

    • Development of predictive models and experimental testing

    • Iterative refinement of functional models based on new data

Sample integrated data analysis:

Data TypeKey FindingIntegration Point
TranscriptomicsRv0885 upregulated 3.2-fold under hypoxiaCo-expressed with genes in biclusters 0478 and 0590
ProteomicsRv0885 protein levels increase 2.5-fold in cholesterol mediaCorrelation with genes involved in cholesterol metabolism
MetabolomicsAltered cholesterol intermediates in Δrv0885 mutantMechanistic link to specific pathway steps
Protein InteractionsRv0885 interacts with proteins X, Y, ZForms functional complex involved in transport
Structural PredictionsPotential anion channel in TM domains 4-6Supports role in ion/metabolite transport
Mutant PhenotypesGrowth defect on cholesterol, normal on glucoseSpecific functional role in lipid metabolism

An integrated model might propose:

This model would then guide further experimental validation through targeted studies of specific aspects of Rv0885 function.

What are the most promising future research directions for understanding Rv0885/MT0908 function in mycobacterial physiology?

Based on current knowledge and gaps in understanding, several research directions appear particularly promising:

  • Structural Biology Approaches:

    • Cryo-EM structure determination of Rv0885 alone or in complex with interacting partners

    • X-ray crystallography of soluble domains or stabilized full-length protein

    • Molecular dynamics simulations to understand conformational changes during transport

  • Systems Biology Integration:

    • Construction of comprehensive regulatory networks including Rv0885

    • Metabolic flux analysis in wild-type vs. mutant strains

    • Machine learning approaches to predict functional interactions

  • Host-Pathogen Interaction Studies:

    • Role of Rv0885 during macrophage infection

    • Impact on immune response and granuloma formation

    • Contribution to persistence and antibiotic tolerance

  • Therapeutic Targeting Potential:

    • Development of small molecule inhibitors targeting Rv0885

    • Assessment of essentiality in different infection models

    • Combination with existing TB therapeutics

These directions should be prioritized based on technological feasibility, potential impact on understanding M. tuberculosis pathogenesis, and possible therapeutic applications.

How might contradictory findings about Rv0885/MT0908 function be reconciled through new experimental approaches?

To address potential contradictions in the literature or preliminary studies:

  • Standardization of Experimental Conditions:

    • Develop consensus protocols for growth, gene expression, and functional studies

    • Use multiple M. tuberculosis strains to account for strain-specific effects

    • Implement robust controls including complementation with wild-type gene

  • Integration of In Vitro and In Vivo Studies:

    • Compare phenotypes in laboratory culture vs. infection models

    • Assess the impact of host factors on Rv0885 function

    • Develop conditional expression systems for temporal control of Rv0885 expression

  • Collaborative Multi-laboratory Validation:

    • Implement round-robin testing of key findings

    • Develop shared reagents and strain repositories

    • Establish data sharing platforms for raw experimental data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.