Recombinant Uncharacterized protein Rv0888/MT0911 (Rv0888, MT0911)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activities

  • Nuclease Activity:

    • Degrades DNA/RNA non-specifically (plasmid DNA, chromosomal DNA, RNA) .

    • Optimal conditions: 41°C, pH 6.5 .

    • Requires divalent cations (Mn²⁺ > Ca²⁺ > Mg²⁺) :

Cation (5 mM)Relative Activity (%)
MnCl₂78.72 ± 1.84
CaCl₂59.89 ± 2.18
MgCl₂42.22 ± 2.06
  • Sphingomyelinase Activity:

    • Cleaves sphingomyelin into phosphocholine and ceramide .

    • Critical for nutrient acquisition and hemolysis .

Inhibitors

Four Chinese medicine monomers inhibit nuclease activity:

  1. Oleuropein

  2. 6-Gingerol

  3. Corylifolinin

  4. Acteoside .

Immune Evasion

  • Degrades neutrophil extracellular traps (NETs) via nuclease activity, facilitating immune escape .

  • Sphingomyelinase activity induces NET formation, exacerbating lung inflammation .

Nutrient Acquisition

  • Acts as an outer membrane porin, transporting glucose and phosphocholine .

  • Enables Mtb growth on sphingomyelin as a carbon source .

Lung Injury Induction

  • Recombinant Rv0888-expressing Mycobacterium smegmatis causes:

    • Hemorrhage and inflammatory cell infiltration in murine lungs .

    • Mitochondrial damage in type II pneumocytes (Fig. 6C,D) .

Pathological FeatureInducing Activity
NET formationSphingomyelinase
Caspase-3 activationSphingomyelinase
Cytokine release (IL-6, TNF-α)Both activities

Immune Modulation

  • Increases IL-6 (7.5-fold), TNF-α (4.2-fold), and IL-1β (6.8-fold) in murine models compared to controls .

Research Applications

  • Therapeutic Target: Mutagenesis studies show H481N (sphingomyelinase-deficient) reduces lung injury by 60% .

  • Diagnostic Tool: Used to study Mtb-host interactions due to surface exposure and enzymatic duality .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Target Names
Rv0888, MT0911
Target Protein Sequence
MDYAKRIGQVGALAVVLGVGAAVTTHAIGSAAPTDPSSSSTDSPVDACSPLGGSASSLAA IPGASVPQVGVRQVDPGSIPDDLLNALIDFLAAVRNGLVPIIENRTPVANPQQVSVPEGG TVGPVRFDACDPDGNRMTFAVRERGAPGGPQHGIVTVDQRTASFIYTADPGFVGTDTFSV NVSDDTSLHVHGLAGYLGPFHGHDDVATVTVFVGNTPTDTISGDFSMLTYNIAGLPFPLS SAILPRFFYTKEIGKRLNAYYVANVQEDFAYHQFLIKKSKMPSQTPPEPPTLLWPIGVPF SDGLNTLSEFKVQRLDRQTWYECTSDNCLTLKGFTYSQMRLPGGDTVDVYNLHTNTGGGP TTNANLAQVANYIQQNSAGRAVIVTGDFNARYSDDQSALLQFAQVNGLTDAWVQVEHGPT TPPFAPTCMVGNECELLDKIFYRSGQGVTLQAVSYGNEAPKFFNSKGEPLSDHSPAVVGF HYVADNVAVR
Uniprot No.

Q&A

What are the basic characteristics and functions of Rv0888/MT0911?

Rv0888 is a bifunctional protein from Mycobacterium tuberculosis with both sphingomyelinase and nuclease activities. As a sphingomyelinase, it cleaves sphingomyelin (a major lipid component in eukaryotic cell membranes) into ceramide and phosphocholine . These breakdown products are then utilized by M. tuberculosis as carbon, nitrogen, and phosphorus sources during infection .

Structurally, Rv0888 is an unusual membrane protein with a surface-exposed C-terminal sphingomyelinase domain and a putative N-terminal channel domain that mediates glucose and phosphocholine uptake across the mycobacterial outer membrane . The protein has been proposed to be renamed as SpmT (sphingomyelinase of Mycobacterium tuberculosis) based on its functional characterization .

How does Rv0888 contribute to M. tuberculosis pathogenicity?

Rv0888 contributes to M. tuberculosis pathogenicity through several mechanisms:

  • Nutrient acquisition: By breaking down host sphingomyelin, Rv0888 provides essential nutrients (carbon, nitrogen, and phosphorus) for bacterial survival and replication within host cells .

  • Hemolytic activity: Rv0888 accounts for approximately half of M. tuberculosis's hemolytic activity, consistent with its sphingomyelinase function and the high sphingomyelin content (up to 27%) in erythrocyte membranes .

  • NETs formation: The sphingomyelinase activity of Rv0888 induces the formation of neutrophil extracellular traps (NETs) both in vitro and in mouse lungs . While NETs can trap mycobacteria, they are unable to kill them, and NET formation is associated with increased lung injury and inflammation .

  • Enhanced colonization: When expressed in the non-pathogenic Mycobacterium smegmatis, Rv0888 enhances the bacterium's ability to colonize mouse lungs, demonstrating its direct contribution to virulence .

What experimental evidence supports the role of Rv0888 in M. tuberculosis infection?

Multiple lines of experimental evidence support Rv0888's role in infection:

  • An M. tuberculosis rv0888 deletion mutant failed to grow on sphingomyelin as a sole carbon source and showed poor replication in macrophages, indicating that the bacterium utilizes sphingomyelin during infection through Rv0888 activity .

  • Rv0888 protein levels increase 5-fold in the presence of erythrocytes and 100-fold in the presence of sphingomyelin, suggesting regulatory mechanisms that enhance its expression during infection .

  • In vivo infection studies with recombinant M. smegmatis expressing Rv0888 demonstrated increased persistence in mouse lungs compared to control strains, with corresponding pathological changes in lung tissue .

  • Immunofluorescence staining of frozen lung sections from mice infected with recombinant M. smegmatis expressing Rv0888 showed NET formation, confirmed by the presence of citrulline histone H3 and myeloperoxidase, which are NET-associated proteins .

How do the nuclease and sphingomyelinase domains of Rv0888 functionally interact?

The nuclease and sphingomyelinase activities of Rv0888 represent distinct functional domains within this bifunctional enzyme. Through site-directed mutagenesis studies, researchers have identified critical residues for each function:

  • Nuclease activity: The D438 residue plays a crucial catalytic role in the nuclease function of Rv0888 . Mutation of this residue (D438A) results in loss of nuclease activity while preserving sphingomyelinase function.

  • Sphingomyelinase activity: The H481 residue is essential for sphingomyelinase activity . The H481N mutation abolishes sphingomyelinase function while maintaining nuclease activity.

  • Pathogenicity contribution: Experimental evidence with these mutants shows that the sphingomyelinase activity, rather than the nuclease activity, is primarily responsible for lung injury in mouse models. Mice infected with the Rv0888NS/MS (full protein) or D438A/MS (nuclease-deficient) strains showed similar levels of lung pathology, while those infected with H481N/MS (sphingomyelinase-deficient) exhibited significantly reduced pathological changes .

This functional separation suggests that while both activities may contribute to bacterial survival in different contexts, the sphingomyelinase activity appears to be the primary driver of pathogenesis in pulmonary infection models.

What is the relationship between Rv0888-induced NET formation and lung pathology?

Rv0888's sphingomyelinase activity induces NET formation that contributes to lung pathology through several mechanisms:

  • NET formation pathway: Experimental data indicates that Rv0888's sphingomyelinase activity triggers NET formation through a pathway involving myeloperoxidase (MPO) and caspase-3 activation .

  • Pathological findings: Mice infected with recombinant M. smegmatis expressing Rv0888 with intact sphingomyelinase activity (Rv0888NS/MS or D438A/MS) showed:

    • Significant lung hemorrhage

    • Infiltration of inflammatory cells

    • Bleeding in the bronchiole cavity

    • Higher pathological and histopathological scores compared to controls

  • Mutant comparison: Infection with the sphingomyelinase-deficient mutant (H481N/MS) resulted in:

    • Reduced inflammatory cell infiltration

    • Almost no hemorrhage in the bronchiole cavity

    • Significantly lower pathological scores

  • Molecular markers: Western blotting of bronchoalveolar lavage fluid (BALF) from infected mice showed that Rv0888NS/MS and D438A/MS groups had detectable levels of NET-associated proteins (CitH3, MPO, and histone H4), while these were absent in the H481N/MS group .

These findings collectively demonstrate that the lung injury associated with Rv0888 is mediated primarily through its sphingomyelinase activity-induced NET formation, rather than its nuclease function.

What structural features of Rv0888 enable its dual enzymatic activities?

Rv0888 is a novel bifunctional enzyme with unique structural features that enable its dual activities:

  • Domain organization: Rv0888 contains:

    • A surface-exposed C-terminal sphingomyelinase domain

    • A putative N-terminal channel domain that facilitates substrate transport

  • Key catalytic residues:

    • H353, D387, and D438 are critical for nuclease activity, as identified through site-directed mutagenesis

    • H481 is essential for sphingomyelinase activity

  • Novel structure: Sequence analysis indicates that Rv0888 nuclease exhibits no homology with any known extracellular nucleases, suggesting it represents a novel class of nucleases .

  • Subcellular localization: Subcellular fractionation studies with recombinant M. smegmatis expressing Rv0888 have identified its location in bacterial fractions, confirming its role as a membrane-associated protein with extracellular enzymatic domains .

The bifunctional nature of Rv0888 highlights how M. tuberculosis has evolved efficient virulence factors that can perform multiple functions to enhance bacterial survival and pathogenesis during infection.

How can researchers effectively express and purify recombinant Rv0888 for functional studies?

For expression and purification of recombinant Rv0888, researchers have successfully employed the following methodological approach:

  • Expression systems:

    • E. coli expression systems have been used for initial characterization of the purified protein

    • For functional studies in mycobacteria, expression in M. smegmatis using the pMV262 vector has proven effective

  • Purification strategy:

    • Overexpression in E. coli followed by standard protein purification techniques including affinity chromatography

    • For studies requiring native conformation, expression in M. smegmatis may better preserve functional activity

  • Functional verification:

    • Nuclease activity: Can be assessed using DNA degradation assays

    • Sphingomyelinase activity: Can be measured by sphingomyelin hydrolysis assays and detection of ceramide formation

    • Optimal conditions: Rv0888 nuclease activity requires divalent cations and has optimal temperature and pH of 41°C and 6.5, respectively

  • Mutant construction: Site-directed mutagenesis targeting specific residues:

    • D438A mutation for nuclease-deficient variant

    • H481N mutation for sphingomyelinase-deficient variant

These approaches allow researchers to obtain functional Rv0888 protein for in vitro enzymatic studies as well as for investigation of its effects in cellular and animal models.

What are the recommended methods for investigating Rv0888's role in NET formation?

To investigate Rv0888's role in NET formation, researchers should consider these methodological approaches:

  • In vitro NET formation assays:

    • Isolate neutrophils from human blood or animal models

    • Expose neutrophils to purified Rv0888 or recombinant bacteria expressing Rv0888

    • Visualize NETs using immunofluorescence microscopy with antibodies against:

      • Citrullinated histone H3 (CitH3)

      • Myeloperoxidase (MPO)

      • Histone H4

    • Quantify NET formation using DNA release assays

  • In vivo detection of NETs:

    • Infect mice with recombinant M. smegmatis expressing Rv0888 (wild-type or mutant variants)

    • Prepare frozen acetone-fixed lung sections

    • Perform immunofluorescence staining for NET markers (CitH3, MPO)

    • Collect bronchoalveolar lavage fluid (BALF) for Western blot analysis of NET-associated proteins

  • Biochemical measurements:

    • Measure ROS levels in serum and lung homogenates

    • Quantify ceramide production to confirm sphingomyelinase activity

    • Assess caspase-3 activation as part of the NET formation pathway

  • Comparative approach:

    • Always include appropriate controls:

      • PBS-treated controls

      • Vector controls (e.g., pMV262/MS)

      • Enzymatic mutants (D438A and H481N) to distinguish between nuclease and sphingomyelinase effects

This methodological framework enables comprehensive assessment of Rv0888's specific role in NET formation and the contribution of each enzymatic activity to this process.

What techniques are most effective for studying the subcellular localization of Rv0888?

For investigating the subcellular localization of Rv0888, researchers have successfully employed these techniques:

  • Subcellular fractionation protocol:

    • Culture recombinant mycobacteria (e.g., M. smegmatis expressing Rv0888)

    • Separate the culture filtrate fraction by centrifugation and filtration

    • Disrupt cells by sonication in buffer containing protease inhibitors

    • Perform differential centrifugation to separate:

      • Cell wall fraction

      • Membrane protein fraction

      • Cytosolic fraction

  • Immunodetection methods:

    • Western blotting of subcellular fractions using Rv0888-specific antibodies

    • Immunofluorescence microscopy to visualize the localization pattern

    • Immunogold electron microscopy for high-resolution localization

  • Reporter fusions:

    • Create GFP or other fluorescent protein fusions with Rv0888

    • Express in mycobacteria to visualize localization in live cells

    • Use domain-specific fusions to determine the localization of specific protein regions

  • Surface accessibility assays:

    • Protease accessibility assays to determine exposed regions

    • Surface biotinylation followed by pull-down experiments

    • Flow cytometry with surface-specific antibodies

These techniques can be combined to provide comprehensive information about the localization of Rv0888, confirming its presence in the mycobacterial outer membrane with surface-exposed enzymatic domains that can interact with host components.

What is the potential of Rv0888 as a drug target for tuberculosis treatment?

Rv0888 represents a promising drug target for tuberculosis treatment based on several key characteristics:

  • Essential for virulence: In vivo infection studies have confirmed that Rv0888 is required for efficient infection and is directly related to pathogenicity . An M. tuberculosis rv0888 deletion mutant showed poor replication in macrophages .

  • Surface accessibility: As an outer membrane protein with surface-exposed enzymatic domains, Rv0888 is potentially accessible to inhibitors without requiring penetration of the mycobacterial cell wall .

  • Dual enzymatic activities: Inhibition strategies could target either or both of Rv0888's enzymatic functions:

    • Sphingomyelinase activity: Critical for nutrient acquisition and NET-mediated pathology

    • Nuclease activity: May contribute to bacterial survival mechanisms

  • Known inhibitors: Four Chinese medicine monomers have already been demonstrated to inhibit Rv0888 nuclease activity, providing proof-of-concept for inhibition strategies .

  • Unique structure: Rv0888 exhibits no homology with known extracellular nucleases, suggesting it represents a novel drug target with potential for selective inhibition .

  • Mutant phenotypes: The attenuated virulence of sphingomyelinase-deficient mutants suggests that targeting this activity could reduce TB-associated lung pathology while potentially preserving host defense mechanisms .

Drug development efforts targeting Rv0888 could focus on high-throughput screening for inhibitors of its enzymatic activities, structure-based drug design (once crystal structures become available), or immunotherapeutic approaches targeting this surface-exposed virulence factor.

How might inhibition of Rv0888 affect M. tuberculosis survival in different host environments?

Inhibition of Rv0888 would likely have differential effects on M. tuberculosis survival depending on the specific host environment:

  • In macrophages:

    • Rv0888 inhibition would impair the bacterium's ability to utilize sphingomyelin as a nutrient source

    • This would be particularly impactful in nutrient-restricted environments within activated macrophages

    • An rv0888 deletion mutant showed poor replication in macrophages, confirming its importance in this environment

  • In lung tissue:

    • Inhibition of Rv0888's sphingomyelinase activity would reduce NET formation and associated inflammatory damage

    • This could potentially reduce pulmonary pathology while simultaneously decreasing bacterial persistence

    • In vivo studies showed that recombinant M. smegmatis expressing Rv0888 with intact sphingomyelinase activity persisted significantly longer in mouse lungs than strains with mutated sphingomyelinase

  • During hemolysis:

    • Rv0888 accounts for approximately half of M. tuberculosis's hemolytic activity

    • Inhibition would reduce access to iron and other nutrients from lysed erythrocytes

    • This could be particularly relevant during disseminated TB infection

  • In granulomas:

    • The nutrient-limited environment of TB granulomas may make Rv0888-mediated nutrient acquisition particularly important

    • Inhibition could potentially reduce long-term bacterial persistence in these structures

The potential differential effects across various host environments highlight the importance of testing Rv0888 inhibitors in diverse model systems that recapitulate different aspects of TB pathogenesis and persistence.

What experimental approaches can be used to evaluate potential inhibitors of Rv0888 activity?

To evaluate potential inhibitors of Rv0888 activity, researchers can employ a multi-tiered experimental approach:

  • In vitro enzymatic assays:

    • Sphingomyelinase activity: Measure hydrolysis of sphingomyelin and production of ceramide and phosphocholine in the presence of inhibitor candidates

    • Nuclease activity: Assess DNA degradation using fluorescent DNA substrates with inhibitor candidates

    • High-throughput screening: Adapt these assays to microplate format for screening chemical libraries

  • Cell-based assays:

    • Macrophage infection model: Test inhibitor effects on M. tuberculosis replication in macrophages

    • Neutrophil NET formation assay: Evaluate inhibitor impact on Rv0888-induced NET formation

    • Cytotoxicity assessment: Ensure inhibitors aren't toxic to host cells

  • Animal model testing:

    • Mouse infection models: Compare bacterial burden and lung pathology in animals treated with inhibitors versus controls

    • Pharmacokinetic/pharmacodynamic studies: Assess inhibitor distribution, metabolism, and efficacy in vivo

    • Combination therapy evaluation: Test Rv0888 inhibitors in combination with standard TB drugs

  • Advanced analytical approaches:

    • Structure-activity relationship analysis: Correlate inhibitor chemical structures with their efficacy

    • X-ray crystallography or cryo-EM: Determine inhibitor binding sites on Rv0888 protein

    • Metabolomic analysis: Assess impact of inhibitors on M. tuberculosis metabolism, particularly sphingomyelin utilization

Inhibitor Evaluation PhaseKey AssaysExpected OutcomesConsiderations
Primary screeningIn vitro enzymatic assaysIdentification of hits with IC₅₀ < 10 μMSelect for specificity to Rv0888 over mammalian enzymes
Secondary validationCell-based assaysConfirmation of activity in cellular contextEvaluate membrane permeability and cytotoxicity
In vivo efficacyMouse infection modelsReduction in bacterial burden and pathologyTest both acute and chronic infection models
Mechanism confirmationRv0888 mutant studiesSimilar effects on WT as Rv0888 mutantsCompare with H481N (sphingomyelinase-deficient) phenotype

This comprehensive approach would enable robust identification and validation of Rv0888 inhibitors with therapeutic potential against tuberculosis.

What are the key unanswered questions about Rv0888's role in M. tuberculosis pathogenesis?

Despite significant progress in understanding Rv0888, several important questions remain unanswered:

  • Regulation mechanisms: How is Rv0888 expression regulated during different stages of infection? Research has shown that Rv0888 levels increase 5-fold in the presence of erythrocytes and 100-fold in the presence of sphingomyelin , but the regulatory mechanisms remain uncharacterized.

  • Substrate specificity: What is the full range of sphingomyelin subtypes that can be processed by Rv0888, and does this contribute to tissue tropism of M. tuberculosis?

  • Interaction with host immune system: Beyond NET formation, how does Rv0888 interact with other components of the host immune response? Does it modulate other aspects of neutrophil or macrophage function?

  • Role in latent infection: Does Rv0888 contribute to the establishment or maintenance of latent TB infection? Is its expression different in latent versus active disease?

  • Redundancy with other enzymes: Are there other M. tuberculosis enzymes with overlapping functions that might compensate for Rv0888 inhibition in therapeutic contexts?

  • Clinical relevance: Do clinical isolates of M. tuberculosis show variation in Rv0888 expression or activity, and does this correlate with disease manifestations or outcomes?

  • Structure-function relationships: What is the detailed three-dimensional structure of Rv0888, and how does this structure enable its dual enzymatic activities?

Addressing these questions will require integrative approaches combining biochemical, structural, immunological, and in vivo infection studies.

How might advanced technologies accelerate research on Rv0888 and similar virulence factors?

Advanced technologies could significantly accelerate Rv0888 research in several ways:

  • Structural biology approaches:

    • Cryo-electron microscopy to determine the membrane-embedded structure of Rv0888

    • Hydrogen-deuterium exchange mass spectrometry to map flexible regions and substrate binding sites

    • AlphaFold or similar AI-based structure prediction to guide experimental approaches

  • Single-cell technologies:

    • Single-cell RNA-seq to determine heterogeneity in host cell responses to Rv0888

    • Mass cytometry to characterize immune cell populations affected by Rv0888 activity

    • Live-cell imaging to track real-time effects of Rv0888 on host cells

  • Advanced genetic approaches:

    • CRISPR-Cas9 screening to identify host factors involved in Rv0888-mediated pathogenesis

    • Conditional gene expression systems to study the temporal requirements for Rv0888 during infection

    • CRISPRi approaches for fine-tuned repression to study dosage effects

  • Systems biology:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand the global impact of Rv0888 on both pathogen and host

    • Network analysis to position Rv0888 within virulence factor networks

    • Mathematical modeling to predict the effects of Rv0888 inhibition on infection dynamics

  • Advanced animal models:

    • Humanized mouse models to better recapitulate human TB pathogenesis

    • Non-human primate models with relevant Rv0888 mutations

    • Organoid technologies to model tissue-specific effects of Rv0888 activity

These technologies could provide more comprehensive understanding of Rv0888's role in TB pathogenesis and accelerate development of targeted interventions.

What interdisciplinary approaches might yield new insights into the functions of Rv0888?

Interdisciplinary approaches could reveal new dimensions of Rv0888 function:

  • Immunology-microbiology interface:

    • Examine how Rv0888-induced NET formation affects subsequent adaptive immune responses

    • Investigate whether Rv0888 activity alters antigen presentation or T cell priming

    • Study potential impact on trained immunity or host memory responses

  • Biochemistry-structural biology integration:

    • Determine crystal structures of Rv0888 in complex with substrates or inhibitors

    • Use molecular dynamics simulations to understand the conformational changes during catalysis

    • Develop structure-based inhibitors targeting the dual enzymatic activities

  • Clinical microbiology-epidemiology collaboration:

    • Analyze Rv0888 sequence and expression variations across clinical isolates

    • Correlate variations with disease manifestations, drug resistance, or clinical outcomes

    • Develop rapid diagnostic tools targeting Rv0888 activity or expression

  • Biophysics-cell biology approaches:

    • Employ advanced imaging techniques like super-resolution microscopy to visualize Rv0888 localization

    • Use atomic force microscopy to study Rv0888's interaction with host membranes

    • Apply microfluidics to study real-time dynamics of Rv0888-mediated processes

  • Computational biology-experimental validation cycle:

    • Use machine learning to predict potential inhibitors based on limited structural data

    • Develop systems biology models of Rv0888's impact on metabolic networks

    • Apply network analysis to identify potential compensatory mechanisms upon Rv0888 inhibition

These interdisciplinary approaches would provide comprehensive understanding of Rv0888's multifaceted roles in M. tuberculosis pathogenesis and could identify novel therapeutic strategies targeting this virulence factor.

What biosafety considerations should researchers be aware of when working with Rv0888?

When working with Rv0888 or recombinant organisms expressing this protein, researchers should adhere to these biosafety guidelines:

  • Biosafety level requirements:

    • Work with wild-type M. tuberculosis requires BSL-3 facilities and practices

    • Recombinant M. smegmatis expressing Rv0888 should be handled at minimum in BSL-2 facilities

    • Purified protein work can generally be conducted at BSL-1 or BSL-2, but institution-specific guidelines should be followed

  • Risk assessment considerations:

    • Rv0888 enhances virulence when expressed in non-pathogenic mycobacteria

    • Its hemolytic activity may increase laboratory exposure risks

    • The protein's ability to induce NET formation may alter host immune responses

  • Specific safety protocols:

    • Use of biological safety cabinets for all aerosol-generating procedures

    • Proper personal protective equipment including respiratory protection when warranted

    • Decontamination procedures effective against mycobacteria

    • Safe handling and disposal of sharps used with recombinant organisms

  • Regulatory compliance:

    • Institutional Biosafety Committee (IBC) approval for recombinant DNA work

    • Proper documentation and risk assessment for all experiments

    • Adherence to national and institutional guidelines for select agent work if applicable

  • Personnel training:

    • Specific training on handling mycobacteria and virulence factors

    • Emergency response protocols for potential exposures

    • Regular updates on best practices for biosafety

These considerations help ensure researcher safety while enabling important scientific investigations into Rv0888's functions and potential as a therapeutic target.

What are the recommended controls for experiments investigating Rv0888 function?

Robust experimental design for Rv0888 research requires appropriate controls:

  • Genetic controls:

    • Wild-type strain: Original M. tuberculosis or M. smegmatis without modifications

    • Vector control: Bacteria containing empty vector (e.g., pMV262/MS)

    • Rv0888 deletion mutant: M. tuberculosis with rv0888 gene deleted

    • Enzymatic mutants: Strains expressing Rv0888 with specific mutations:

      • D438A mutant (nuclease-deficient but sphingomyelinase-active)

      • H481N mutant (sphingomyelinase-deficient but nuclease-active)

      • Double mutants with both activities abolished

  • Biochemical assay controls:

    • Positive controls: Commercial sphingomyelinase or nuclease enzymes

    • Negative controls: Heat-inactivated enzymes

    • Substrate controls: Verify sphingomyelin or DNA purity and integrity

    • Inhibitor specificity controls: Test effects on unrelated enzymes

  • Cellular and animal model controls:

    • Vehicle controls: PBS or buffer-treated cells/animals

    • Complemented strains: Rv0888 deletion mutant with restored gene expression

    • Host response controls: Include known NET inducers (e.g., PMA) for comparison

    • Time-course sampling: To distinguish early from late effects

  • Technical controls:

    • Antibody specificity verification: For immunodetection methods

    • Loading controls: For protein quantification in Western blots

    • Multiple biological and technical replicates: To ensure reproducibility

    • Randomization and blinding: For animal experiments and histopathological scoring

This comprehensive control strategy ensures that experimental observations can be confidently attributed to specific activities of Rv0888, enabling accurate interpretation of results.

How can researchers overcome technical challenges in studying Rv0888 function?

Researchers may encounter several technical challenges when studying Rv0888, for which these solutions are recommended:

  • Protein expression and purification challenges:

    • Challenge: Membrane proteins are difficult to express and purify in functional form

    • Solution: Use specialized expression systems (e.g., mycobacterial hosts), detergent screening, and gentle purification methods

    • Alternative: Consider expressing functional domains separately if full-length protein is problematic

  • Enzymatic activity measurement:

    • Challenge: Dual activities may interfere with each other in assays

    • Solution: Use mutant proteins (D438A or H481N) as controls to distinguish between activities

    • Approach: Develop coupled assays that specifically detect products of each enzymatic reaction

  • In vivo relevance assessment:

    • Challenge: Difficulty translating in vitro findings to in vivo significance

    • Solution: Use multiple model systems (cell culture, organoids, animal models)

    • Strategy: Compare recombinant M. smegmatis with wild-type M. tuberculosis where BSL-3 facilities are available

  • NET formation analysis:

    • Challenge: Distinguishing specific Rv0888 effects from general inflammatory responses

    • Solution: Use specific inhibitors, enzymatic mutants, and appropriate controls

    • Technique: Employ multiple detection methods (immunofluorescence, Western blotting, DNA quantification)

  • Structural characterization:

    • Challenge: Membrane proteins are difficult to crystallize

    • Solution: Consider cryo-EM, NMR of specific domains, or computational modeling

    • Approach: Use structure prediction tools in combination with experimental validation

  • Translational barriers:

    • Challenge: Developing inhibitors with appropriate specificity and pharmacokinetics

    • Solution: Structure-guided design combined with medicinal chemistry optimization

    • Strategy: Focus on surface-exposed, enzymatically critical residues unique to mycobacterial enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.