Recombinant Uncharacterized protein Rv0897c/MT0921 (Rv0897c, MT0921)

What is Recombinant Uncharacterized protein Rv0897c/MT0921?

Recombinant Uncharacterized protein Rv0897c/MT0921 is a full-length protein (1-535 amino acids) with UniProt ID P64751. It is typically expressed in E. coli with an N-terminal His-tag for purification purposes. The protein is supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE. The complete amino acid sequence begins with MSDHDRDFDVVVVGGGHNGLVAAAYLARAGLRVRLLERLAQTGG and contains multiple functional domains that suggest enzymatic activity, though its precise function remains to be fully characterized .

How should Recombinant Uncharacterized protein Rv0897c/MT0921 be stored?

For optimal stability and activity retention, store the protein at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles which can compromise protein integrity. For working aliquots, storage at 4°C for up to one week is recommended. The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What is the recommended reconstitution protocol?

The reconstitution procedure significantly impacts protein stability and experimental reproducibility. The vial should be briefly centrifuged prior to opening to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) is advised for long-term storage at -20°C/-80°C. This glycerol addition helps prevent freeze-damage and maintains protein stability over extended storage periods .

How should I design experiments to investigate the potential function of Rv0897c/MT0921?

When designing experiments to investigate this uncharacterized protein, you should follow a systematic approach:

• Define your variables clearly - identify the independent variable (e.g., protein concentration, buffer conditions, potential substrates) and dependent variable (e.g., enzymatic activity, binding affinity, structural changes) .

• Develop a specific, testable hypothesis based on in silico sequence analysis. The amino acid sequence contains motifs suggesting oxidoreductase activity (GGGHNGLVAAAYLARA), which can guide initial functional assays .

• Design experimental treatments with appropriate controls. This should include:

  • Negative controls (buffer only, heat-inactivated protein)

  • Positive controls (known related proteins if available)

  • Concentration gradients to establish dose-dependency

• Plan your measurements carefully, using both direct (e.g., spectrophotometric activity assays) and indirect methods (e.g., structural changes upon substrate binding) .

A well-designed factorial experiment can efficiently examine multiple variables simultaneously, particularly when examining buffer conditions, potential cofactors, and substrate specificity .

What are the key considerations for protein-protein interaction studies with Rv0897c/MT0921?

When investigating protein-protein interactions involving Rv0897c/MT0921:

• Consider potential interference from the His-tag - compare results with tag-cleaved preparations when possible.

• Design experiments with both quantitative (binding kinetics) and qualitative (confirmation of interaction) elements.

• Select appropriate methodologies based on research questions:

• Control for non-specific binding, particularly when working with His-tagged proteins, by including appropriate blocking steps and stringent washing conditions .

How can comparative expression analysis be used to understand the role of Rv0897c/MT0921 in mycobacterial pathogenesis?

To investigate the role of Rv0897c/MT0921 in pathogenesis, comparative expression analysis can be employed following these methodological approaches:

• Design comparative transcriptomic studies between virulent and attenuated mycobacterial strains, focusing on expression patterns of Rv0897c/MT0921 during infection. Previous studies have demonstrated significant differences in gene expression between strains like H37Rv and attenuated variants with RD1 deletions .

• Establish a time-course experiment examining expression at multiple infection timepoints (e.g., 6, 24, 48 hours post-infection) as different strains have shown time-dependent expression patterns of virulence-associated genes .

• Employ both RNA-seq and RT-qPCR methodologies for validation, as this combination provides both comprehensive transcriptome data and precise quantification of target gene expression.

• Correlate expression data with phenotypic observations, particularly focusing on virulence characteristics, immune response modulation, and survival within macrophages.

The expression analysis should be conducted in relevant infection models, including macrophage cell lines and primary cells, to capture physiologically relevant conditions .

What approaches can be used to generate and analyze Rv0897c/MT0921 knockout or knockdown models?

Creating and analyzing Rv0897c/MT0921 mutants requires careful methodological planning:

• Design knockout strategy based on mycobacterial genome organization, considering:

  • Potential polar effects on neighboring genes

  • Essential gene status verification (Rv0897c may be essential)

  • Appropriate selection markers for mycobacterial systems

• Methods for genetic manipulation include:

  • Homologous recombination-based approaches

  • CRISPR-Cas9 systems adapted for mycobacteria

  • Conditional knockdown systems for essential genes

• Validation strategies should combine:

  • PCR confirmation of gene deletion

  • RT-qPCR to confirm absence of transcript

  • Western blot to verify protein absence

  • Complementation studies to confirm phenotype specificity

• Phenotypic characterization should evaluate:

  • Growth kinetics in standard media and stress conditions

  • Virulence in cellular and animal models

  • Metabolic profiling to identify pathway disruptions

  • Transcriptomic analysis to identify compensatory mechanisms

Research has demonstrated that single gene deletions can affect expression of genes outside the deleted locus, highlighting the importance of genome-wide expression analysis in knockout studies .

What are the optimal conditions for expressing and purifying Recombinant Uncharacterized protein Rv0897c/MT0921?

For optimal expression and purification:

• Expression system considerations:

  • E. coli BL21(DE3) is commonly used for mycobacterial protein expression

  • Consider strain variants with enhanced disulfide bond formation capabilities if the protein contains multiple cysteines

  • Optimize induction conditions (IPTG concentration, temperature, duration)

• Purification strategy:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin is the primary method for His-tagged proteins

  • Second purification step using size exclusion chromatography improves homogeneity

  • Buffer optimization is crucial - the protein is stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

• Quality control assessments:

  • SDS-PAGE for purity evaluation (>90% purity standard)

  • Western blotting for identity confirmation

  • Dynamic Light Scattering for aggregation assessment

  • Activity assays if functional characteristics are known

• Yield optimization through factorial design experiments testing:

  • Media composition (LB, TB, auto-induction)

  • Induction OD₆₀₀ (typically 0.6-0.8)

  • Post-induction temperature (16°C, 25°C, 37°C)

  • Induction duration (3h, 6h, overnight)

What analytical methods are recommended for structural characterization of Rv0897c/MT0921?

A comprehensive structural characterization requires multiple complementary approaches:

• Primary structure verification:

  • Mass spectrometry (MS) for molecular weight confirmation

  • Peptide mass fingerprinting following tryptic digestion

  • N-terminal sequencing to confirm intact N-terminus

• Secondary structure analysis:

  • Circular Dichroism (CD) spectroscopy at far-UV range (190-260 nm)

  • Fourier Transform Infrared Spectroscopy (FTIR)

• Tertiary structure determination:

  • X-ray crystallography (requires successful crystallization)

  • Nuclear Magnetic Resonance (NMR) for proteins <30 kDa or domains

  • Cryo-electron microscopy for larger complexes

• Structural stability assessment:

  • Thermal shift assays to determine melting temperature

  • Limited proteolysis to identify flexible regions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

Each method provides complementary information, and the integration of multiple approaches yields the most comprehensive structural understanding .

How should functional data from Rv0897c/MT0921 experiments be analyzed and interpreted?

For rigorous data analysis and interpretation:

• Apply appropriate statistical methods:

  • Parametric tests (t-tests, ANOVA) for normally distributed data

  • Non-parametric alternatives when normality cannot be assumed

  • Multiple testing correction when analyzing large datasets

  • Power analysis to ensure adequate sample sizes

• Interpret results in biological context:

  • Compare with known related proteins (e.g., other mycobacterial oxidoreductases)

  • Consider the protein's genomic context and potential operon structure

  • Evaluate results against existing literature on mycobacterial physiology

  • Integrate with systems biology datasets when available

• Validation approaches:

  • Technical replicates to assess method reliability

  • Biological replicates to account for natural variation

  • Orthogonal methods to confirm key findings

  • Blind analysis to minimize experimenter bias

• Results presentation should include:

  • Clear data tables with means, standard deviations, and statistical significance

  • Appropriate data visualization (scatter plots for individual data points)

  • Raw data availability for transparency

  • Detailed methodology for reproducibility

What bioinformatic approaches can predict function of Rv0897c/MT0921 to guide experimental design?

Bioinformatic prediction should follow these methodological steps:

• Sequence-based function prediction:

  • BLAST searches against characterized proteins

  • Multiple sequence alignment with homologous proteins

  • Motif identification using PROSITE, PFAM, and InterPro

  • Phylogenetic analysis to identify evolutionary relationships

• Structure-based analysis:

  • Homology modeling based on related proteins with known structures

  • Molecular docking to predict potential substrates/ligands

  • Molecular dynamics simulations to study flexibility and binding sites

  • Binding site prediction and conservation analysis

• Genomic context analysis:

  • Operon structure examination

  • Gene neighborhood conservation across mycobacterial species

  • Co-expression patterns in transcriptomic datasets

  • Protein-protein interaction network analysis

• Integration with experimental data:

  • Correlate predictions with preliminary biochemical results

  • Iteratively refine hypotheses based on experimental outcomes

  • Prioritize experiments based on confidence scores from predictions

  • Design targeted assays to test specific functional predictions

These comprehensive approaches provide a systematic framework for unraveling the function of this uncharacterized protein, guiding efficient experimental design and hypothesis generation .