Recombinant Uncharacterized protein Rv0961/MT0989 (Rv0961, MT0989)

Shipped with Ice Packs
In Stock

Description

Introduction to Uncharacterized Protein Rv0961/MT0989

Uncharacterized protein Rv0961/MT0989 is a protein encoded by the Rv0961 gene in Mycobacterium tuberculosis, the causative agent of tuberculosis. The protein is designated as "uncharacterized" indicating that its precise biological function has not yet been fully elucidated. The protein is identified by multiple nomenclature systems, including Rv0961 (referring to the gene locus in the H37Rv reference strain) and MT0989 (referring to the corresponding gene in the CDC1551 clinical isolate) . These designations are commonly used in mycobacterial genomics to track genes and their products across different reference strains.

The protein consists of 115 amino acids, making it a relatively small protein in the mycobacterial proteome . Despite its uncharacterized status, commercial sources have developed recombinant versions of this protein to facilitate research into its structure, function, and potential role in mycobacterial physiology or pathogenesis. These recombinant versions are produced through various expression systems and are made available to the scientific community for research purposes.

The study of uncharacterized proteins like Rv0961/MT0989 represents an important frontier in mycobacterial research, as uncovering the functions of these proteins may reveal novel insights into tuberculosis pathogenesis, potential drug targets, or diagnostic markers. As tuberculosis remains a significant global health challenge, characterizing previously unknown proteins from M. tuberculosis continues to be a priority for researchers in the field.

Recombinant Production Methods

The production of recombinant Rv0961/MT0989 protein utilizes several expression systems, with Escherichia coli being the most commonly documented host organism . The E. coli expression system offers advantages including rapid growth, high protein yields, and established protocols for protein purification. This system is particularly suitable for producing mycobacterial proteins for research purposes due to its efficiency and cost-effectiveness.

In commercial preparations, the recombinant protein is typically produced with affinity tags to facilitate purification. The most common tag appears to be a histidine (His) tag, which enables purification through immobilized metal affinity chromatography (IMAC) . According to product specifications, the recombinant protein may contain both N-terminal and C-terminal tags, with the specific tag configurations determined by various factors including tag-protein stability . These tags not only aid in purification but may also serve as epitopes for detection in experimental applications.

Alternative expression systems are also available for producing this recombinant protein, including yeast, baculovirus, and mammalian cell systems . Each system offers distinct advantages for protein folding, post-translational modifications, or yield optimization. The choice of expression system may impact the structural and functional properties of the recombinant protein, potentially influencing its suitability for specific research applications. The availability of multiple expression systems provides researchers with options to obtain the most appropriately produced protein for their particular experimental needs.

Research Applications and Potential Functions

Despite its uncharacterized status, Rv0961/MT0989 represents a valuable research tool for investigating Mycobacterium tuberculosis biology. The availability of recombinant preparations enables various experimental approaches, including structural studies, protein-protein interaction analyses, and immunological investigations. These studies may contribute to elucidating the protein's function and its potential role in mycobacterial physiology or pathogenesis.

One potential research application involves using the recombinant protein as an antigen for generating specific antibodies. Such antibodies could enable detection and localization studies to determine the protein's expression patterns and subcellular distribution within mycobacterial cells. Additionally, the recombinant protein might serve as a substrate in functional assays designed to screen for enzymatic activities or binding interactions with other molecules, potentially revealing its biological role.

While the specific function of Rv0961/MT0989 remains to be determined, its investigation may be informed by studying other mycobacterial proteins with known functions. For instance, the research on the CFP-10 and ESAT-6 proteins, which form a tight 1:1 complex that plays an essential role in tuberculosis pathogenesis, provides a model for how seemingly uncharacterized proteins can ultimately be revealed as critical virulence factors . These proteins were found to bind to the surface of macrophages and monocytes, suggesting a key signaling role in modulating host cell behavior to the advantage of the pathogen. Similar functional studies with Rv0961/MT0989 could potentially uncover comparable roles in mycobacterial pathogenesis.

Challenges in Studying Uncharacterized Proteins

The study of uncharacterized proteins like Rv0961/MT0989 presents several significant challenges. The foremost challenge is the absence of known homologs with characterized functions that could provide clues to the protein's role. Without such comparative information, researchers must employ de novo approaches to functional characterization, which can be time-consuming and resource-intensive. These approaches may include structural studies, protein-protein interaction screens, and phenotypic analyses of gene deletion mutants.

Another challenge lies in the potential difficulties of expressing and purifying mycobacterial proteins in heterologous systems. Mycobacterial proteins often have unique properties related to their GC-rich coding sequences, codon usage preferences, and potential requirements for mycobacteria-specific folding mechanisms or post-translational modifications. These factors can affect the production of functionally relevant recombinant proteins for experimental studies. The use of multiple expression systems, as seen with commercial preparations of Rv0961/MT0989, represents an attempt to address these challenges.

Establishing the biological relevance of in vitro findings represents a further challenge in studying uncharacterized proteins. Observations made with recombinant proteins must ultimately be validated in the context of the living mycobacterium and during host infection to establish their physiological significance. This validation typically requires genetic manipulation of the bacterium, which can be technically challenging in Mycobacterium tuberculosis due to its slow growth and pathogenic nature. Despite these challenges, the systematic study of uncharacterized proteins continues to be essential for comprehensively understanding mycobacterial biology and identifying new targets for therapeutic intervention.

Future Research Directions

Future research on Rv0961/MT0989 should prioritize comprehensive functional characterization using multiple complementary approaches. High-resolution structural determination through X-ray crystallography or NMR spectroscopy would provide valuable insights into the protein's potential function based on structural motifs, binding pockets, or similarity to proteins of known function. Such structural information could guide hypothesis generation regarding the protein's biological role and potential interacting partners.

Systematic protein-protein interaction studies represent another promising direction for future research. Techniques such as yeast two-hybrid screening, pull-down assays, or proximity labeling methods could identify potential binding partners of Rv0961/MT0989 within the mycobacterial proteome or host proteins during infection. The identification of interaction partners would provide context for understanding the protein's function within cellular pathways and processes.

Genetic approaches, including gene deletion, complementation, and conditional expression studies, would be valuable for determining the essentiality of Rv0961 and its impact on mycobacterial physiology and virulence. The phenotypic characterization of mutant strains under various growth conditions and during infection models could reveal the circumstances under which the protein plays critical roles. Additionally, transcriptomic and proteomic analyses comparing wild-type and mutant strains could identify regulatory networks associated with Rv0961, further illuminating its biological significance in Mycobacterium tuberculosis biology and pathogenesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Target Names
Rv0961, MT0989
Target Protein Sequence
MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH
Uniprot No.

Q&A

What is the structural and sequence information available for Rv0961/MT0989?

Rv0961/MT0989 is a 115-amino acid protein with the following primary sequence: MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHVFPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH . Based on computational predictions and annotations, it is classified as a probable integral membrane protein . The protein is encoded by a gene located at coordinates 1074074-1074421 in the positive orientation of the Mycobacterium tuberculosis H37Rv genome . The amino acid sequence suggests multiple hydrophobic regions consistent with transmembrane domains, which supports its classification as an integral membrane protein.

What is known about the expression profile of Rv0961/MT0989?

Transcriptomic studies using DNA microarrays have revealed an interesting expression pattern for Rv0961. The gene shows detectable expression in M. tuberculosis H37Rv in vivo when studied in BALB/c and SCID mice models, but interestingly, expression is not detected in vitro when grown in standard 7H9 medium . This differential expression pattern suggests that Rv0961 may play a role specifically during infection or in response to host environmental factors. The expression profile indicates potential involvement in host-pathogen interactions, although the exact regulatory mechanisms controlling its expression remain to be fully characterized.

What are the recommended storage and handling protocols for recombinant Rv0961/MT0989 protein?

For optimal stability and activity of recombinant Rv0961/MT0989 protein, the following storage and handling protocols are recommended:

  • Storage temperature: Store at -20°C/-80°C for long-term preservation .

  • Buffer composition: The protein is typically provided in Tris/PBS-based buffer containing 6% trehalose (pH 8.0) or Tris-based buffer with 50% glycerol .

  • Reconstitution: For lyophilized protein, briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Aliquoting: Add glycerol to a final concentration of 5-50% (with 50% being standard) and prepare small working aliquots to avoid repeated freeze-thaw cycles .

  • Working storage: Short-term working aliquots can be stored at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as it may compromise protein integrity and activity .

These protocols help maintain protein stability and functionality for experimental applications while minimizing degradation or loss of activity.

What expression systems are available for producing recombinant Rv0961/MT0989, and how do they compare?

Multiple expression systems have been developed for producing recombinant Rv0961/MT0989, each with distinct characteristics:

Expression SystemProduct FeaturesTagged VersionsApplicationsSource
E. coliFull-length (1-115aa), high expression yieldsHis-tagged, Avi-tag BiotinylatedFunctional studies, antibody production
YeastPartial length, eukaryotic post-translational modificationsVarious tags availableStudies requiring eukaryotic modifications
BaculovirusComplex protein expression, insect cell modificationsVarious tags availableStructural studies, protein-protein interactions
Mammalian cellsNative-like folding and modificationsVarious tags availableStudies requiring mammalian-specific modifications

The E. coli system offers high yields and is most commonly used, with proteins typically achieving >90% purity as determined by SDS-PAGE . For specialized applications requiring specific post-translational modifications or complex folding environments, the eukaryotic expression systems may be preferable despite their typically lower yields. The tag types can often be customized during the production process to suit specific experimental needs .

What experimental approaches can be used to study membrane localization of Rv0961/MT0989?

Given that Rv0961/MT0989 is annotated as a probable integral membrane protein, several experimental approaches can be employed to confirm and characterize its membrane localization:

  • Subcellular fractionation: Separate bacterial cellular components through differential centrifugation to isolate membrane fractions, followed by Western blotting using anti-Rv0961 antibodies or anti-tag antibodies for recombinant versions.

  • Membrane protein extraction techniques:

    • Use detergent-based methods with varying stringency (e.g., Triton X-114 phase separation)

    • Apply alkaline extraction to differentiate integral from peripheral membrane proteins

  • Fluorescence microscopy approaches:

    • Express fluorescently tagged Rv0961 (e.g., GFP fusion) to visualize localization

    • Perform immunofluorescence with specific antibodies against Rv0961 or epitope tags

  • Protease accessibility assays:

    • Test the susceptibility of intact cells, spheroplasts, or membrane vesicles to protease digestion

    • Analyze protected fragments to map membrane topology

  • Computational topology prediction:

    • Use hydropathy analysis and topology prediction algorithms to identify potential transmembrane segments

    • Compare predictions with experimental results from protease accessibility or reporter fusion studies

These approaches, when used in combination, can provide comprehensive evidence of membrane localization and topology, helping to understand the functional context of this uncharacterized protein in the bacterial cell envelope.

How might the differential expression of Rv0961/MT0989 in vivo versus in vitro inform functional hypotheses?

The observation that Rv0961/MT0989 expression is detected in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) provides valuable clues for developing functional hypotheses:

  • Host-induced expression: The selective expression in vivo suggests that Rv0961 responds to specific host environmental cues absent in standard laboratory media. These could include:

    • Changes in pH, oxygen tension, or nutrient availability within host compartments

    • Exposure to host immune factors (cytokines, antimicrobial peptides)

    • Adaptation to intracellular life within macrophages or other host cells

  • Potential functional roles based on expression pattern:

    • Host-pathogen interaction: May participate in interactions with host cell receptors, immune evasion, or modification of the host environment

    • Adaptation to stress: Could be involved in stress responses specific to the host environment

    • Nutrient acquisition: Might function in transport or utilization of host-specific nutrients

  • Experimental approaches to test these hypotheses:

    • Culture M. tuberculosis under conditions mimicking various host microenvironments to identify specific triggers for Rv0961 expression

    • Perform RNA-seq under defined stress conditions to identify co-regulated genes

    • Create reporter strains with the Rv0961 promoter region driving expression of fluorescent proteins to monitor activation patterns

Understanding the regulatory mechanisms controlling this differential expression could provide important insights into M. tuberculosis adaptation during infection and potentially identify new targets for therapeutic intervention.

What are the implications of Rv0961/MT0989 being found deleted in some clinical isolates?

The observation that Rv0961/MT0989 is found to be partially or completely deleted in some clinical isolates of M. tuberculosis has several important implications for understanding its role in pathogenesis and bacterial evolution:

  • Selective pressure analysis:

    • The deletion in clinical isolates suggests the gene may be under negative selection in certain host environments

    • Alternatively, it could indicate genetic drift of a non-essential gene

    • Comparing the geographical distribution and patient characteristics associated with these deleted variants may reveal specific selective pressures

  • Functional compensation mechanisms:

    • Since these deletion variants presumably remain viable, other genes likely compensate for any lost functions

    • Comparative genomic analysis of isolates with and without Rv0961 could identify potential compensatory mutations or upregulated alternative pathways

  • Clinical and evolutionary significance:

    • Correlation with virulence: Determining whether isolates lacking Rv0961 show altered virulence, transmissibility, or drug resistance

    • Evolutionary trajectory: Assessing whether these deletions represent ongoing genome reduction in certain lineages

    • Host adaptation: Investigating if deletions are associated with adaptation to specific host populations or anatomical niches

  • Experimental approaches:

    • Compare transcriptomic and proteomic profiles between wild-type and natural deletion variants

    • Perform infection studies with deletion variants to assess changes in host response

    • Conduct complementation studies to determine if reintroduction of Rv0961 alters phenotypes

This natural variation provides a valuable opportunity to understand gene function through "natural experiments" that complement traditional laboratory gene knockout approaches.

How can structural and functional prediction tools be applied to generate hypotheses about Rv0961/MT0989 function?

Given the uncharacterized nature of Rv0961/MT0989, computational prediction tools offer valuable approaches for generating testable hypotheses about its structure and function:

  • Transmembrane topology prediction:

    • Analysis of the 115-amino acid sequence using tools such as TMHMM, MEMSAT, or Phobius to predict membrane-spanning regions

    • Identification of potential extracellular and cytoplasmic domains that might mediate interactions

  • Structural modeling approaches:

    • Template-based modeling using structurally characterized membrane proteins with similar features

    • Ab initio modeling for regions lacking homology to known structures

    • Molecular dynamics simulations to predict conformational dynamics in membrane environments

  • Functional domain and motif identification:

    • Search for conserved domains using databases like Pfam, PROSITE, or InterPro

    • Identify potential binding sites, post-translational modification sites, or catalytic residues

    • Compare conservation patterns across mycobacterial species to identify functionally important residues

  • Systems biology integration:

    • Analyze gene neighborhood and synteny across bacterial genomes

    • Examine protein-protein interaction predictions based on co-expression, genetic interactions, or phylogenetic profiling

    • Identify metabolic pathways or cellular processes where Rv0961 might participate

  • Experimental validation strategies:

    • Design site-directed mutagenesis of predicted functional residues

    • Create chimeric proteins to test domain functions

    • Develop binding assays for predicted interaction partners

By combining multiple computational approaches and integrating them with the limited experimental data available, researchers can develop prioritized hypotheses for targeted experimental investigation of this uncharacterized protein.

How should researchers address the challenges of studying an uncharacterized membrane protein like Rv0961/MT0989?

Studying uncharacterized membrane proteins like Rv0961/MT0989 presents several unique challenges that require specialized approaches:

  • Solubilization and purification challenges:

    • Optimization of detergent selection: Test a panel of detergents (mild non-ionic, zwitterionic, and ionic) to identify optimal conditions for maintaining native structure

    • Use of membrane mimetics: Consider nanodiscs, liposomes, or amphipols for stabilization during purification and functional studies

    • Consider fusion partners (e.g., MBP, SUMO) to enhance solubility while maintaining function

  • Structural characterization approaches:

    • Employ complementary methods: Combine techniques like circular dichroism, FTIR, and tryptophan fluorescence to assess secondary structure maintenance

    • Consider solid-state NMR or cryo-EM for structural determination if crystallization proves challenging

    • Use limited proteolysis coupled with mass spectrometry to map domain organization and accessibility

  • Functional assignment strategies:

    • Phenotypic screening: Compare wild-type and knockout strains under diverse conditions (stress, different carbon sources, host-relevant conditions)

    • Chemical biology approaches: Use photo-crosslinking or activity-based protein profiling to identify interaction partners

    • Transport assays: If a transport function is suspected, conduct radioactive substrate uptake studies in reconstituted systems

  • Data integration and interpretation:

    • Build a weight-of-evidence approach combining computational predictions with experimental observations

    • Consider evolutionary context by examining conservation patterns across mycobacterial species

    • Develop multiple working hypotheses and design critical experiments to distinguish between them

By systematically addressing these challenges, researchers can make significant progress in characterizing this membrane protein despite the initial lack of functional information.

What experimental controls are critical when working with recombinant Rv0961/MT0989 protein?

When working with recombinant Rv0961/MT0989 protein, implementing rigorous controls is essential to ensure valid and reproducible results. The following controls should be considered:

  • Protein quality controls:

    • Purity assessment: SDS-PAGE with multiple staining methods (Coomassie, silver, Western blot) to verify >90% purity

    • Identity confirmation: Mass spectrometry analysis to confirm the correct molecular weight and sequence

    • Aggregation assessment: Size exclusion chromatography or dynamic light scattering to detect aggregation

    • Tag-cleaved controls: Compare protein with and without affinity tags to assess tag interference with function

  • Functional assay controls:

    • Denatured protein control: Heat-denatured or chemically denatured protein to distinguish specific from non-specific effects

    • Tag-only control: Express and purify the tag portion alone to identify tag-mediated effects

    • Buffer components control: Test buffer components without protein to identify buffer-mediated effects

  • Expression system considerations:

    • Expression system comparison: When possible, compare protein expressed in different systems (E. coli, yeast, mammalian) to identify system-specific artifacts

    • Endotoxin testing: For proteins expressed in E. coli, verify endotoxin levels are below thresholds that could affect cell-based assays

  • Storage and handling controls:

    • Freeze-thaw stability: Compare fresh protein with samples subjected to freeze-thaw cycles

    • Time-course stability: Test protein activity over time under storage conditions

    • Temperature sensitivity: Compare protein kept at recommended storage temperatures versus suboptimal conditions

How can researchers integrate data from Rv0961/MT0989 studies with broader tuberculosis research?

Integrating research on Rv0961/MT0989 with the broader context of tuberculosis research requires strategic approaches to data collection, analysis, and interpretation:

  • Multi-omics data integration:

    • Correlate Rv0961 expression patterns with global transcriptomic, proteomic, and metabolomic datasets

    • Map potential interactions within protein-protein interaction networks in M. tuberculosis

    • Position Rv0961 within known regulatory networks and stress response pathways

  • Phenotypic correlation analysis:

    • Systematic phenotyping of Rv0961 knockout strains across diverse conditions

    • Compare phenotypes with those of other gene knockouts to identify functional relationships

    • Analyze infection models to correlate Rv0961 expression with stages of infection and disease progression

  • Evolutionary and comparative genomic approaches:

    • Compare conservation and variation patterns across clinical isolates and laboratory strains

    • Examine presence, absence, and sequence variation in related mycobacterial species

    • Identify co-evolving genes that may functionally interact with Rv0961

  • Integration with host response data:

    • Analyze host transcriptomic responses to wild-type versus Rv0961 knockout strains

    • Investigate potential interactions with host factors given the in vivo expression pattern

    • Examine correlations between Rv0961 expression and clinical outcomes in patient samples

  • Translational research connections:

    • Assess Rv0961 as a potential biomarker given its in vivo expression pattern

    • Evaluate as a potential vaccine component or drug target if functionally significant

    • Investigate diagnostic applications, particularly for in vivo detection of active infection

By contextualizing Rv0961 research within these broader frameworks, researchers can both contribute to understanding the specific protein and advance the field of tuberculosis research as a whole.

What are promising experimental approaches to elucidate the function of Rv0961/MT0989?

Several innovative experimental strategies could help determine the function of this uncharacterized protein:

  • Conditional gene expression systems:

    • Develop tetracycline-inducible or repressible systems to modulate Rv0961 expression during infection

    • Monitor phenotypic changes under different host-relevant conditions

  • Host-pathogen interaction studies:

    • Perform macrophage infection studies comparing wild-type and Rv0961 knockout strains

    • Analyze differentially regulated host genes to identify affected pathways

    • Use fluorescently tagged Rv0961 to track localization during infection

  • Interactome mapping:

    • Apply proximity-labeling approaches (BioID, APEX) to identify neighboring proteins in the membrane

    • Perform co-immunoprecipitation studies with cross-linking to capture transient interactions

    • Use bacterial two-hybrid systems adapted for membrane proteins

  • Metabolic profiling:

    • Compare metabolic profiles of wild-type and knockout strains under various conditions

    • Test specific substrate utilization patterns that might reveal transporter activity

    • Perform isotope labeling studies to track metabolic fluxes

  • High-resolution imaging:

    • Apply super-resolution microscopy to precisely localize Rv0961 within the cell

    • Use correlative light and electron microscopy to examine ultrastructural context

    • Perform time-lapse imaging during infection to capture dynamic processes

These approaches, especially when combined, offer pathways to functional insights even for challenging uncharacterized membrane proteins.

How might emerging technologies advance our understanding of proteins like Rv0961/MT0989?

Emerging technologies offer unprecedented opportunities to characterize previously uncharacterized proteins like Rv0961/MT0989:

  • AI-powered structural prediction:

    • AlphaFold2 and RoseTTAFold can now predict membrane protein structures with increasing accuracy

    • Combined with molecular dynamics simulations to model membrane interactions

    • Integration with experimental validation through limited proteolysis or cross-linking mass spectrometry

  • Single-cell technologies:

    • Single-cell RNA-seq of infected host cells to correlate Rv0961 expression with host cell states

    • Spatial transcriptomics to map expression patterns within granulomas or infected tissues

    • CyTOF or single-cell proteomics to correlate protein expression with cellular heterogeneity

  • CRISPR-based approaches:

    • CRISPRi for fine-tuned knockdown to assess dosage effects

    • CRISPR screening with specialized libraries targeting membrane protein function

    • Base editing for precise amino acid substitutions to test functional hypotheses

  • Advanced imaging techniques:

    • Cryo-electron tomography to visualize Rv0961 in its native membrane context

    • Live-cell single-molecule tracking to analyze dynamics and interactions

    • Expansion microscopy for enhanced resolution of membrane organization

  • Systems biology integration:

    • Multi-scale modeling incorporating molecular, cellular, and tissue-level data

    • Network analysis tools to position Rv0961 within functional modules

    • Machine learning approaches to predict function from integrated datasets

These technologies provide powerful new ways to overcome traditional limitations in studying uncharacterized membrane proteins and could lead to breakthrough discoveries about Rv0961's function in M. tuberculosis pathogenesis.

What are the key takeaways for researchers beginning work on Rv0961/MT0989?

Researchers initiating studies on Rv0961/MT0989 should consider these essential points:

  • Basic characteristics:

    • Rv0961 is a 115-amino acid probable integral membrane protein from M. tuberculosis

    • It shows differential expression: detected in vivo but not in standard in vitro conditions

    • It is non-essential for in vitro growth and is deleted in some clinical isolates

  • Research approaches:

    • Employ complementary methods spanning computational prediction, biochemical characterization, and functional genomics

    • Consider its membrane protein nature when designing expression, purification, and functional assays

    • Integrate findings with the broader context of M. tuberculosis pathogenesis

  • Practical considerations:

    • Multiple recombinant protein options are available with different tags and expression systems

    • Optimal storage involves -20°C/-80°C with 50% glycerol, avoiding repeated freeze-thaw cycles

    • Rigorous controls are essential, particularly when working with membrane proteins

  • Knowledge gaps and opportunities:

    • The specific function remains uncharacterized despite genomic and expression data

    • The in vivo-specific expression pattern presents opportunities to study host adaptation

    • Natural variation in clinical isolates offers evolutionary insights

By approaching this uncharacterized protein with these considerations in mind, researchers can make meaningful contributions to understanding M. tuberculosis pathogenesis and potentially identify new therapeutic targets.

How does research on uncharacterized proteins like Rv0961/MT0989 contribute to tuberculosis research more broadly?

Investigation of uncharacterized proteins like Rv0961/MT0989 makes several important contributions to tuberculosis research:

  • Expanding the functional genome:

    • Approximately 25% of the M. tuberculosis genome remains functionally uncharacterized

    • Each newly characterized protein fills critical gaps in our understanding of pathogen biology

    • Uncharacterized proteins may represent "dark matter" of M. tuberculosis biology with novel functions

  • Revealing adaptation mechanisms:

    • Proteins like Rv0961 with in vivo-specific expression patterns may represent specialized adaptations to the host environment

    • Understanding these adaptations provides insights into persistence mechanisms

    • May reveal new drug targets that address in vivo-specific aspects of infection

  • Evolutionary perspectives:

    • Studying proteins deleted in some clinical isolates helps understand genome plasticity

    • Reveals non-essential genes that may nevertheless contribute to fitness in specific niches

    • Contributes to understanding the evolutionary trajectory of the pathogen

  • Methodological advances:

    • Challenging proteins drive development of new research techniques

    • Membrane protein methods developed for Rv0961 could benefit studies of other membrane proteins

    • Integration of computational and experimental approaches strengthens tuberculosis research methodology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.