Recombinant Uncharacterized protein Rv0970/MT0998 (Rv0970, MT0998)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Uncharacterized Protein Rv0970/MT0998 corresponds to the Rv0970 gene (also annotated as MT0998) in M. tuberculosis, encoding a hypothetical protein of unknown function. Its UniProt ID is P64781. The recombinant version is synthesized using heterologous expression systems, enabling studies on its potential role in tuberculosis pathogenesis or bacterial physiology .

Key Identifiers:

PropertyDetail
OrganismMycobacterium tuberculosis
Gene NameRv0970, MT0998
UniProt IDP64781
Protein Length210 amino acids
Molecular Weight~23 kDa (calculated)

Production and Purification

The recombinant protein is typically expressed in E. coli, yeast, or mammalian systems, fused with an N-terminal His-tag for affinity chromatography .

Research Applications

Though functionally uncharacterized, this protein is employed in:

  • ELISA Development: Used as an antigen for antibody validation .

  • Protein Interaction Studies: Screened via yeast two-hybrid or pull-down assays .

  • Structural Biology: Crystallization trials for 3D modeling .

Quality Control and Validation

Rigorous quality assessments ensure batch consistency:

  • Purity Analysis: SDS-PAGE and Western blot .

  • Stability Testing: Repeated freeze-thaw cycles are not recommended .

Research Limitations and Future Directions

The lack of functional annotation limits hypothesis-driven studies. Current research focuses on:

  • Identifying interactors via proteomic screens.

  • Mapping its role in M. tuberculosis virulence using knockout models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Target Names
Rv0970, MT0998
Target Protein Sequence
MIHDLMLRWVVTGLFVLTAAECGLAIIAKRRPWTLIVNHGLHFAMAVAMAVMAWPWGARV PTTGPAVFFLLAAVWFGATAVVAVRGTATRGLYGYHGLMMLATAWMYAAMNPRLLPVRSC TEYATEPDGSMPAMDMTAMNMPPNSGSPIWFSAVNWIGTVGFAVAAVFWACRFVMERRQE ATQSRLPGSIGQAMMAAGMAMLFFAMLFPV
Uniprot No.

Q&A

What is known about the genomic context of Rv0970/MT0998?

The Rv0970/MT0998 gene is located in the Mycobacterium tuberculosis genome and has been identified through genomic sequencing. Like many mycobacterial proteins with Rv/MT designations, this nomenclature indicates its identification in reference strains of M. tuberculosis. The Rv designation refers to the H37Rv reference strain, while MT refers to the CDC1551 clinical isolate. Understanding the genomic context can provide initial insights into potential functional relationships with adjacent genes and possible operon structures .

What are the predicted structural features of Rv0970/MT0998?

Based on sequence analysis, Rv0970/MT0998 is predicted to be a hypothetical protein with currently uncharacterized function. Bioinformatic analysis suggests the protein may contain specific domains that could indicate potential functional roles. Common prediction tools like PSIPRED, I-TASSER, and AlphaFold can be used to generate potential structural models. These computational approaches provide a starting point for experimental validation, though they should be interpreted cautiously until confirmed through methods like X-ray crystallography or NMR spectroscopy .

What expression systems are recommended for recombinant production of Rv0970/MT0998?

For recombinant production of mycobacterial proteins like Rv0970/MT0998, Escherichia coli expression systems are often the first choice due to their ease of use and high yield. The BL21(DE3) strain is particularly useful for expression of mycobacterial proteins due to its lack of certain proteases. For optimal expression, consider using vectors with inducible promoters such as pET series vectors with T7 promoters. Alternative expression systems include mycobacterial hosts like M. smegmatis, which may provide more native-like post-translational modifications but typically yield lower protein amounts .

How can I confirm the identity of purified recombinant Rv0970/MT0998?

Confirmation of purified Rv0970/MT0998 should involve multiple analytical techniques. Western blotting using anti-His antibodies (if a His-tag was incorporated) provides initial verification. Mass spectrometry remains the gold standard, with techniques like MALDI-TOF or LC-MS/MS allowing for precise molecular weight determination and peptide sequencing. A typical confirmation workflow should include:

  • SDS-PAGE to assess purity and approximate molecular weight

  • Western blot with appropriate antibodies

  • Mass spectrometry for definitive identification

  • N-terminal sequencing for additional verification

What approaches are most effective for functional characterization of Rv0970/MT0998?

Functional characterization of uncharacterized proteins like Rv0970/MT0998 requires multiple complementary approaches. Begin with computational prediction of potential functions based on sequence homology, domain architecture, and structural modeling. Follow with targeted experimental approaches including:

  • Gene knockout or knockdown studies in M. tuberculosis to assess essentiality

  • Transcriptomic analysis to identify conditions affecting expression

  • Proteomic approaches to identify interaction partners

  • Biochemical assays to test predicted enzymatic activities

  • Phenotypic screening of mutants under various stress conditions

A systematic combination of these approaches provides the most comprehensive functional characterization, particularly when results from multiple methods converge on consistent functional hypotheses .

How can I investigate potential protein-protein interactions involving Rv0970/MT0998?

Investigation of protein-protein interactions for Rv0970/MT0998 requires both in vitro and in vivo approaches. Begin with pull-down assays using tagged recombinant Rv0970/MT0998 as bait against mycobacterial lysates. Co-immunoprecipitation with antibodies specific to Rv0970/MT0998 can identify native interaction partners. For comprehensive interactome mapping, consider:

  • Yeast two-hybrid screening against a mycobacterial library

  • Bacterial two-hybrid systems, which may be more suitable for mycobacterial proteins

  • Proximity-dependent biotin labeling (BioID) for in vivo interaction mapping

  • Cross-linking mass spectrometry (XL-MS) to capture transient or weak interactions

Confirmation of identified interactions should involve reciprocal pull-downs and functional validation through co-localization studies or mutational analysis of interaction interfaces .

What role might Rv0970/MT0998 play in M. tuberculosis pathogenesis based on current evidence?

While specific pathogenic roles for Rv0970/MT0998 remain to be determined, several approaches can help investigate its potential contributions to virulence. Expression analysis during infection models can indicate whether the protein is upregulated during host interaction. Comparative genomics across mycobacterial species can reveal whether the gene is conserved in pathogenic strains but absent in non-pathogenic ones, suggesting virulence functions.

To experimentally assess pathogenic roles:

  • Generate knockout strains and test for attenuation in cellular and animal infection models

  • Evaluate the protein's expression during different stages of infection

  • Assess subcellular localization during host interaction

  • Investigate potential immunomodulatory effects on host cells

These approaches collectively can provide insights into whether Rv0970/MT0998 contributes to M. tuberculosis pathogenesis and through what mechanisms .

What are the optimal conditions for expression and purification of recombinant Rv0970/MT0998?

Optimizing expression and purification of Rv0970/MT0998 requires systematic testing of multiple conditions. For E. coli-based expression systems, consider the following parameters:

  • Expression temperature: 18°C often yields better folding for mycobacterial proteins

  • Induction concentration: Lower IPTG concentrations (0.1-0.5 mM) typically improve solubility

  • Growth media: Enriched media like Terrific Broth often increases yield

  • Co-expression with chaperones: GroEL/GroES can improve folding of mycobacterial proteins

For purification, a typical workflow includes:

  • Initial capture via affinity chromatography (IMAC for His-tagged proteins)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

The buffer composition should be optimized through stability screening, with typical starting conditions including 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and 5% glycerol to enhance stability .

How can I design gene knockout experiments to study the function of Rv0970/MT0998?

Designing effective gene knockout experiments for Rv0970/MT0998 requires careful consideration of mycobacterial genetics. For M. tuberculosis, specialized techniques are needed due to low transformation efficiency and slow growth. Consider the following approaches:

  • Homologous recombination using specialized vectors like pJM1 or pYUB854

  • Transposon mutagenesis libraries for initial essentiality screening

  • CRISPR-Cas9 based methods, though these are still being optimized for mycobacteria

  • Conditional knockdown systems if the gene proves essential

A comprehensive experimental design should include:

  • Construction of knockout vectors with appropriate selectable markers

  • Confirmation of gene deletion by PCR and sequencing

  • Complementation studies to verify phenotypes are specific to gene deletion

  • Growth curve analysis under various conditions

  • Stress response testing (oxidative, acid, nutrient limitation)

  • Virulence assessment in cellular and animal models

Controls should include wild-type strains and complemented mutants to ensure observed phenotypes are directly attributable to Rv0970/MT0998 disruption .

What structural biology techniques are most appropriate for resolving the structure of Rv0970/MT0998?

Determining the structure of Rv0970/MT0998 requires selecting appropriate techniques based on protein properties. X-ray crystallography remains the gold standard but requires well-diffracting crystals. NMR spectroscopy is valuable for smaller proteins or dynamic regions. Cryo-electron microscopy (cryo-EM) has emerged as powerful for proteins resistant to crystallization.

A comprehensive structural biology approach would include:

  • Initial screening with circular dichroism to assess secondary structure content

  • Crystallization trials with various constructs and conditions

  • NMR studies for dynamic regions or if the protein is under 25 kDa

  • Cryo-EM for larger assemblies or membrane-associated forms

  • Small-angle X-ray scattering (SAXS) for solution-state conformation

Computational predictions using AlphaFold2 can guide experimental design by identifying structured domains and disordered regions that may impact crystallization. Integrating multiple structural techniques provides the most comprehensive structural characterization .

How can expression data for Rv0970/MT0998 be analyzed across different experimental conditions?

Analyzing expression data for Rv0970/MT0998 across varied conditions requires robust statistical approaches and appropriate normalization. For transcriptomic data (RNA-seq or microarray), consider the following:

  • Normalize using established methods like RPKM/FPKM or TPM for RNA-seq data

  • Apply appropriate statistical tests (DESeq2, edgeR) to identify significant changes

  • Compare expression patterns with co-regulated genes

  • Integrate with regulatory network information

The following table summarizes example expression data analysis from a hypothetical study of Rv0970/MT0998 under various stress conditions:

ConditionLog2 Fold Changep-valueFDRCo-regulated genes
Hypoxia2.340.00120.008Rv0971, Rv0969, Rv0973
Acid stress1.870.00310.015Rv1733c, Rv2031c
Nutrient starvation3.210.00050.003Rv0970, Rv3133c
Oxidative stress0.430.12430.312None significant
Macrophage infection2.750.00080.006Rv0967, Rv0970, Rv1738

Clustering analysis of expression patterns can reveal functional relationships with genes of known function, providing clues to Rv0970/MT0998's role in mycobacterial physiology .

How do I resolve contradictory results in Rv0970/MT0998 functional studies?

Contradictory results are common when characterizing uncharacterized proteins like Rv0970/MT0998. Resolving such discrepancies requires systematic analysis of experimental variables and methodological differences. Consider these approaches:

  • Evaluate strain differences: Results may vary between lab strains and clinical isolates

  • Assess experimental conditions: Growth phase, media composition, and stress levels can affect outcomes

  • Compare methodological details: Different assay sensitivities or detection methods may explain variations

  • Consider genetic compensation: Adaptive responses may mask phenotypes in some experimental setups

A structured approach to resolving contradictions involves:

  • Repeating key experiments with standardized protocols

  • Testing multiple complementary methods to assess the same function

  • Collaborating with labs reporting different results to identify variables

  • Considering whether contradictory results actually reveal condition-specific functions

Document all experimental conditions meticulously, including strain details, growth conditions, and exact methodological parameters to facilitate comparison across studies and resolution of apparent contradictions .

What bioinformatic approaches can predict potential functions of Rv0970/MT0998?

Bioinformatic prediction of Rv0970/MT0998 function should employ multiple algorithms and databases to increase confidence. Key approaches include:

  • Sequence homology using BLAST against well-characterized proteins

  • Domain identification using InterPro, Pfam, and SMART databases

  • Structural modeling using AlphaFold2 followed by structural similarity searches

  • Gene neighborhood analysis to identify functional relationships

  • Co-evolution analysis to predict interaction partners

The following table summarizes hypothetical results from bioinformatic prediction approaches:

MethodPredictionConfidence ScoreSupporting Evidence
BLAST homologyPossible oxidoreductase65%Weak homology to known oxidoreductases
Domain predictionNAD(P)-binding domain87%Rossmann fold detected by InterPro
Structural modelingStructural similarity to dehydrogenases76%AlphaFold2 model aligns with known dehydrogenases
Gene neighborhoodCo-occurrence with stress response genesN/AConserved gene cluster in pathogenic mycobacteria
Evolutionary analysisCo-evolution with redox proteins72%Significant correlation with thioredoxin system proteins

Integration of multiple prediction methods provides a consensus hypothesis that can guide targeted experimental validation of Rv0970/MT0998 function .

How does Rv0970/MT0998 compare to homologous proteins in other mycobacterial species?

Comparative analysis of Rv0970/MT0998 with homologs in other mycobacterial species can provide evolutionary insights and functional clues. Sequence conservation patterns often highlight functionally important residues. A comprehensive analysis should include:

  • Multiple sequence alignment across diverse mycobacterial species

  • Phylogenetic analysis to understand evolutionary relationships

  • Conservation mapping onto predicted structural models

  • Comparison of genomic context across species

The following table presents a hypothetical comparison of Rv0970/MT0998 across selected mycobacterial species:

SpeciesIdentity (%)Similarity (%)Gene Context PreservedKey Variations
M. tuberculosis H37Rv100100ReferenceNone
M. tuberculosis CDC155199.8100Yes1 conservative aa substitution
M. bovis98.599.2Yes3 aa substitutions in C-terminal region
M. marinum85.392.1PartiallyExtended N-terminal region
M. smegmatis76.884.5NoInsertions in central domain
M. leprae82.488.7YesTruncated C-terminus
M. avium79.286.3PartiallyVariable central domain

Higher conservation in pathogenic mycobacteria would suggest potential roles in virulence, while conservation across all mycobacteria would indicate more fundamental cellular functions .

What can we learn from studying protein-protein interaction networks involving Rv0970/MT0998?

Protein-protein interaction networks provide critical context for understanding Rv0970/MT0998 function. Comprehensive interactome analysis can reveal functional modules and biological processes involving this protein. Approaches to network analysis include:

  • Direct interactome mapping using affinity purification-mass spectrometry

  • Yeast two-hybrid screening against the mycobacterial proteome

  • Computational prediction of interactions based on co-expression data

  • Integration with existing mycobacterial interactome databases

A hypothetical interaction network analysis might reveal patterns like these:

Interaction PartnerDetection MethodInteraction StrengthFunctional Category
Rv0971AP-MS, Y2HStrongCell wall biosynthesis
Rv3133c (DosR)Co-IPModerateHypoxia response
Rv2031c (HspX)SPINEWeakStress response
Rv0967BioIDModerateLipid metabolism
Rv3418c (GroEL)AP-MSWeakProtein folding
Rv2623Y2HModeratePersistence
Rv0973cCrosslinking-MSStrongUnknown function

Network visualization and pathway enrichment analysis can further reveal functional clusters and potential biological roles based on the characterized interaction partners. This provides a functional context even when the direct function of Rv0970/MT0998 remains unknown .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.