Recombinant Uncharacterized protein Rv1280c/MT1317 (Rv1280c, MT1317)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the order type and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, with associated surcharges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Target Names
Rv1280c, MT1317
Target Protein Sequence
MADRGQRRGCAPGIASALRASFQGKSRPWTQTRYWAFALLTPLVVAMVLTGCSASGTQLE LAPTADRRAAVGTTSDINQQDPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKA TLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINPEAVWSDGTPITWRDIASQIH AISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTA TPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAAR LPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLA IAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDNSGVVAYNPEQAKRELDALGW RRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVN VGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARAL ANQVDELIWAEGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRR
Uniprot No.

Q&A

What is the Rv1980c gene and what protein does it encode?

The Rv1980c gene of Mycobacterium tuberculosis encodes the MPT64 protein, which is considered a virulence factor due to its ability to stimulate immune responses in tuberculosis patients . This protein is secreted during the early phase of M. tuberculosis infection and plays a significant role in pathogenesis by transferring bacteria from the phagosome into the cell cytoplasm during initial infection . The protein has a molecular weight of approximately 36 kDa as determined by SDS-polyacrylamide gel electrophoresis and Western blotting .

What are the unique characteristics of the MPT64 protein that make it valuable for research?

MPT64 possesses several unique characteristics that make it valuable for research:

  • It contains specific epitopes recognized by both T cells and B cells in patients with tuberculosis

  • It strongly induces T cells and interferon-gamma (IFN-γ) production

  • It is found exclusively among the virulence factors of M. tuberculosis and not in non-tuberculosis mycobacteria

  • It has multiple immunogenic regions that can be targeted for diagnostic and vaccine development

These properties make MPT64 a promising candidate for both serodiagnostic testing and recombinant vaccine development against tuberculosis.

What is the optimal experimental design approach for studying MPT64 recombinant protein expression?

For studying MPT64 recombinant protein expression, a true experimental design is recommended, which should include the following methodological steps:

  • PCR amplification of the Rv1980c gene from M. tuberculosis clinical isolates or reference strain H37Rv

  • Insertion of the amplified gene into an expression vector (such as pET SUMO plasmid)

  • Transformation into a competent expression host (E. coli BL21(DE3) cells are commonly used)

  • Induction of protein expression using IPTG (1.0 M concentration has been reported as effective)

  • Confirmation of expression using SDS-PAGE and Western blotting

  • Purification of the recombinant protein for further analysis

This approach ensures high internal validity through controlled manipulation of variables while allowing for rigorous analysis of the protein's characteristics.

How should researchers design experiments to validate the immunogenic properties of MPT64?

To validate the immunogenic properties of MPT64, researchers should implement a quasi-experimental design approach that includes:

  • Preparation of purified recombinant MPT64 protein

  • Collection of serum samples from:

    • Confirmed TB patients (test group)

    • Non-TB subjects (control group)

    • BCG-vaccinated individuals (to test cross-reactivity)

  • Implementation of immunological assays such as ELISA, Western blotting, or T-cell proliferation assays

  • Statistical analysis of the results to determine sensitivity and specificity

  • Epitope mapping to identify the most immunogenic regions

When random assignment is not possible (as with clinical samples), researchers should control for confounding variables by matching subjects based on age, sex, and other relevant factors to enhance internal validity .

What epitopes in the MPT64 protein are recognized by T cells and B cells?

Based on computational and experimental analyses, the MPT64 protein contains multiple epitopes recognized by both T cells and B cells. The following tables summarize these epitopes:

Table 1: T-cell Epitopes of MPT64 Protein

T-cell Epitope MethodAmino Acid PositionSequence
Iad Pattern Position9-14LKGTDT
Iad Pattern Position57-62LSAATS
Iad Pattern Position59-64AATSST
Iad Pattern Position60-65ATSSTP
Iad Pattern Position72-77LNITSA
Iad Pattern Position77-82ATYQSA
Iad Pattern Position85-90PRGTQA
Iad Pattern Position105-110TTTYKA
Iad Pattern Position195-200VLVPRS
Rothbard/Taylor Pattern26-29DPAY
Rothbard/Taylor Pattern55-58KFLS
Rothbard/Taylor Pattern67-70EAPY
Rothbard/Taylor Pattern109-112KAFD
Rothbard/Taylor Pattern119-122KPIT
Rothbard/Taylor Pattern162-165DPVN
Rothbard/Taylor Pattern184-188ELLPE
Rothbard/Taylor Pattern188-191EAAG

Table 2: B-cell Epitopes of MPT64 Protein

The study identified 5 B-cell epitope positions using Immune Epitope Database (IEDB) analysis .

These epitopes are critical for the development of effective diagnostics and vaccines, as they determine the specificity and sensitivity of immune responses to the protein.

How does the sequence of MPT64 compare between different M. tuberculosis strains?

Sequencing analysis of the Rv1980c gene from clinical isolates of M. tuberculosis shows a high degree of conservation. Sequence alignment using ClustalW and BLAST reveals:

  • 100% similarity with the original sequence of M. tuberculosis H37Rv reference strain

  • High conservation among clinical isolates, including drug-resistant strains

  • Presence in M. tuberculosis variant bovis BCG and strain BCG SL222

  • No significant similarity with non-TB mycobacteria

This high conservation makes MPT64 a reliable target for diagnostic applications across different M. tuberculosis strains.

What methodological considerations are important when using MPT64 for diagnostic test development?

When developing diagnostic tests based on MPT64, researchers should consider:

  • Expression System Selection: Intracellular vs. extracellular expression systems affect protein yield and conformation. Previous research has shown that expression in E. coli BL21(DE3) cells resulted in detection of the recombinant MPT64 protein both intracellularly (cytosol) and in the periplasmic area .

  • Protein Purification Strategy: The choice between native purification and denaturation-refolding affects epitope conformation. For maintaining conformational epitopes, native purification is preferred.

  • Assay Format Optimization: ELISA, lateral flow assays, or other immunological platforms should be compared for sensitivity and specificity using:

    • Serum samples from confirmed TB patients

    • Negative controls from healthy individuals

    • Samples from patients with other respiratory diseases to assess cross-reactivity

  • Statistical Validation: Diagnostic accuracy should be evaluated through:

    • Receiver Operating Characteristic (ROC) curve analysis

    • Calculation of sensitivity, specificity, positive predictive value, and negative predictive value

    • Determination of the optimal cut-off value for distinguishing positive from negative samples

How can epitope mapping data be utilized for designing more effective TB vaccines?

Epitope mapping data can be strategically utilized for designing more effective TB vaccines through the following approaches:

  • Multi-epitope Vaccine Design: Combining multiple strong T-cell and B-cell epitopes from MPT64 with epitopes from other M. tuberculosis antigens to create a broad-spectrum immune response.

  • Adjuvant Selection: Based on the type of immune response desired (Th1/Th2 balance), appropriate adjuvants can be selected to enhance immune response to specific MPT64 epitopes.

  • Delivery System Optimization: Different delivery systems (viral vectors, nanoparticles, DNA vaccines) can be compared for their ability to present MPT64 epitopes effectively to the immune system.

  • In silico Prediction and Validation: Computational prediction of population coverage based on epitope binding to different HLA alleles, followed by experimental validation in diverse population samples.

  • Prime-Boost Strategies: Testing whether sequential administration of different MPT64-based vaccine formulations enhances immune memory and protection.

What are the common challenges in expressing MPT64 recombinant protein and how can they be addressed?

Researchers frequently encounter several challenges when expressing MPT64 recombinant protein:

  • Low Expression Yield:

    • Solution: Optimize codon usage for the expression host, adjust induction conditions (IPTG concentration, temperature, duration), or try different expression vectors.

  • Protein Aggregation and Inclusion Body Formation:

    • Solution: Lower the induction temperature (16-20°C), reduce IPTG concentration, or co-express with molecular chaperones.

  • Proteolytic Degradation:

    • Solution: Add protease inhibitors, use protease-deficient host strains, or optimize the purification process to minimize exposure time.

  • Protein Solubility Issues:

    • Solution: Use solubility-enhancing fusion tags (such as SUMO, MBP, or GST) or optimize buffer conditions during purification.

  • Conformational Integrity:

    • Solution: Employ native purification methods or develop refolding protocols that preserve the conformational epitopes critical for immunological studies.

How should researchers analyze conflicting data regarding MPT64 immunogenicity across different studies?

When faced with conflicting data regarding MPT64 immunogenicity across different studies, researchers should implement a systematic analytical approach:

What novel experimental approaches could enhance our understanding of MPT64 function in M. tuberculosis pathogenesis?

To advance our understanding of MPT64 function in M. tuberculosis pathogenesis, researchers should consider these innovative experimental approaches:

  • CRISPR-Cas9 Gene Editing:

    • Create precise Rv1980c knockout or knockdown mutants in M. tuberculosis

    • Generate point mutations in specific epitope regions to assess their functional importance

  • Single-Cell Analysis:

    • Employ single-cell RNA-seq to examine host cell responses to MPT64 exposure

    • Use mass cytometry (CyTOF) to characterize immune cell populations responding to MPT64

  • Structural Biology Approaches:

    • Determine high-resolution crystal or cryo-EM structures of MPT64

    • Perform molecular dynamics simulations to understand protein-host interactions

  • Advanced Imaging Techniques:

    • Use super-resolution microscopy to track MPT64 localization during infection

    • Implement live-cell imaging to visualize MPT64-mediated bacterial translocation

  • Systems Biology Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of MPT64 function

    • Identify interaction networks and regulatory pathways affected by MPT64

How might MPT64-based diagnostics be integrated with other biomarkers for improved TB detection?

For improved TB detection, MPT64-based diagnostics could be integrated with other biomarkers through these methodological approaches:

  • Multiplexed Assay Development:

    • Design assays that simultaneously detect MPT64 alongside other M. tuberculosis antigens (ESAT-6, CFP-10, LAM)

    • Incorporate host biomarkers (cytokines, microRNAs) that reflect disease activity

  • Machine Learning Algorithms:

    • Develop predictive models using multiple biomarker inputs to improve diagnostic accuracy

    • Implement feature selection to identify the most informative biomarker combinations

  • Point-of-Care Integration:

    • Design simplified testing platforms that combine MPT64 detection with molecular methods

    • Create smartphone-based readers for multiplexed lateral flow assays

  • Longitudinal Biomarker Profiling:

    • Establish algorithms for interpreting patterns of biomarker expression over time

    • Identify biomarker signatures that predict treatment response or disease progression

  • Validation in Diverse Clinical Settings:

    • Test integrated diagnostic approaches in populations with varying TB prevalence

    • Evaluate performance in challenging diagnostic scenarios (HIV co-infection, extrapulmonary TB)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.