Recombinant Uncharacterized protein Rv1290c/MT1328 (Rv1290c, MT1328)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Uncharacterized Protein Rv1290c/MT1328

Recombinant Uncharacterized Protein Rv1290c/MT1328 (UniProt ID: P0A5E3) is a bioengineered version of a protein encoded by the Rv1290c/MT1328 gene in Mycobacterium tuberculosis. While its precise biological function remains undefined, it is studied for its potential role in bacterial pathogenesis and therapeutic applications . The protein spans 521 amino acids (aa 1–521) and is commonly expressed in E. coli with an N-terminal His-tag for purification .

Key Properties

ParameterValueSource
LengthFull-length (1–521 aa)
TagHis-tag (N-terminal)
Host SystemE. coli (primary); Yeast/Baculovirus/Mammalian (alternative)
Purity≥85–90% (SDS-PAGE-verified)
Storage-20°C/-80°C (lyophilized or glycerol-stabilized)

Amino Acid Sequence

The sequence begins with MLQRSLGVNGRKLAMSARSAKRERKNASTAASKCYVVPPSARGWVHAYSVTATSMLNRRK (partial) and includes motifs suggestive of transmembrane domains or enzymatic activity .

Pathways and Interactions

Though not fully characterized, Rv1290c/MT1328 is implicated in:

  • Pathogenicity: Linked to M. tuberculosis survival and drug resistance mechanisms .

  • Protein Interactions: Hypothetical interactions with bacterial enzymes or membrane proteins (methods: yeast two-hybrid, co-IP) .

Vaccine Development

Recombinant Rv1290c/MT1328 is explored as a candidate antigen for tuberculosis vaccines, particularly targeting drug-resistant strains .

Future Directions

While Rv1290c/MT1328’s role in tuberculosis remains unclear, its recombinant form enables functional studies to elucidate its involvement in bacterial stress responses or antigenic presentation. Further research is critical to validate its therapeutic potential .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Target Names
Rv1290c, MT1328
Target Protein Sequence
MLQRSLGVNGRKLAMSARSAKRERKNASTAASKCYVVPPSARGWVHAYSVTATSMLNRRK AILDYLQGAVWVLPTFGVAIGLGSGAVLSMIPVKSGTLIDKLMFQGTPGDARGVLIVVSA TMITTIGIVFSLTVLSLQIASSQFSVRLLRTFLRDVPNQVVLAIFACTFAYSTGGLHTVG EHRDGGAFIPKVAVTGSLALAFVSIAALIYFLHHLMHSIQIDTIMDKVRLRTLGLVDQLY PESDTADRQVETPPSPPADAVPLLAPHSGYLQTVDVDDIAELAAASRYTALLVTFVGDYV TAGGLLGWCWRRGTAPGAPGSDFPQRCLRHVHIGFERTLQQDIRFGLRQMVDIALRALSP ALNDPYTAIQVVHHLSAVESVLASRALPDDVRRDRAGELLFWLPYPSFATYLHVGCAQIR RYGSREPLVLTALLQLLSAVAQNCVDPSRRVAVQTQIALVVRAAQREFADESDRAMVLGA AARATEVVERPGTLAPPPSTFGQVAAAQAAASTIRSADRDG
Uniprot No.

Q&A

What is Rv1290c/MT1328 and where is it located in Mycobacterium tuberculosis?

Rv1290c (also known as MT1328) is a conserved protein in Mycobacterium tuberculosis H37Rv with unknown function but thought to be involved in virulence. The gene is located at coordinates 1443482-1445047 on the negative strand of the M. tuberculosis genome . The protein consists of 521 amino acids and has been classified in the functional category of "conserved hypotheticals." Proteomics studies have identified this protein in the cytosol of M. tuberculosis H37Rv using 2DLC/MS techniques and whole cell lysates, but not in the culture filtrate or membrane protein fraction .

What is known about the homology of Rv1290c/MT1328 to other proteins?

Rv1290c shows similarity to a hypothetical protein found in Streptomyces coelicolor (AL031013|SC8A6.09), with FASTA scores indicating an optimized score of 371, E-value of 9.5e-17, and 28.3% identity over a 446 amino acid overlap . This moderate level of sequence conservation with a protein from a different bacterial genus suggests potential functional conservation across actinobacteria, although the function remains unknown in both organisms. Comparative genomics approaches may help elucidate the protein's role by identifying patterns of conservation across mycobacterial species and related bacteria.

Is Rv1290c/MT1328 essential for Mycobacterium tuberculosis survival?

Multiple independent studies employing different transposon mutagenesis approaches have demonstrated that Rv1290c is non-essential for in vitro growth of M. tuberculosis H37Rv. This has been confirmed using various techniques including:

  • Himar1 transposon mutagenesis in MtbYM rich medium (Minato et al. 2019)

  • Analysis of saturated Himar1 transposon libraries (DeJesus et al. 2017)

  • Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (Sassetti et al., 2003; Lamichhane et al., 2003)

  • Tn5370 transposon mutagenesis of H37Rv strain (McAdam et al., 2002)

Importantly, while Rv1290c is non-essential for in vitro growth, mutants lacking this gene demonstrate reduced virulence in SCID (Severe Combined Immunodeficiency) mice, suggesting its potential role in pathogenesis rather than basic cellular metabolism .

What experimental approaches have been used to characterize the function of Rv1290c/MT1328?

The function of Rv1290c has been investigated through multiple complementary approaches:

  • Genetic disruption studies: Transposon mutagenesis has been employed by multiple research groups to assess the essentiality of Rv1290c for growth and virulence. These studies have consistently shown that while the gene is dispensable for in vitro growth, it appears to contribute to virulence in animal models .

  • Proteomics analyses: Mass spectrometry-based proteomics has been used to identify the subcellular localization of Rv1290c. Studies by Mawuenyega et al. (2005) and de Souza et al. (2011) identified the protein in the cytosolic fraction and whole cell lysates, but not in culture filtrates or membrane fractions, suggesting it functions within the bacterial cytoplasm .

  • Comparative genomics: Sequence similarity searches have identified homologs in other actinobacteria, including Streptomyces coelicolor, providing potential insights into conserved functions .

  • In vivo virulence testing: Studies using SCID mice have demonstrated that Rv1290c mutants exhibit attenuated virulence, suggesting a role in host-pathogen interactions .

These approaches collectively provide a foundation for understanding Rv1290c, though definitive functional characterization remains incomplete.

How do Rv1290c/MT1328 mutants affect virulence in animal models of tuberculosis?

Experimental evidence indicates that Rv1290c plays a role in the virulence of M. tuberculosis in animal models. McAdam et al. (2002) demonstrated that while Rv1290c is non-essential for in vitro growth, mutants with disruptions in this gene show reduced virulence in SCID mice . This suggests that Rv1290c may contribute to mechanisms that allow M. tuberculosis to establish and maintain infection in immunocompromised hosts.

The specific mechanisms through which Rv1290c impacts virulence remain to be fully elucidated. Possible functions may include:

  • Evasion of host immune responses

  • Adaptation to the intracellular environment of macrophages

  • Resistance to host-generated stress conditions

  • Modulation of host cell signaling or death pathways

Further research using more sophisticated animal models, including immunocompetent mice and non-human primates, would provide additional insights into the role of Rv1290c in tuberculosis pathogenesis across different immune contexts.

What is the significance of Rv1290c/MT1328 being classified as a "conserved hypothetical" protein?

The classification of Rv1290c as a "conserved hypothetical" protein indicates that while the gene is conserved across multiple mycobacterial species and possibly other bacterial genera (suggesting functional importance), its precise biochemical and physiological functions remain unknown . This classification presents both challenges and opportunities for researchers:

Research challenges:

  • Lack of obvious functional domains or motifs to guide hypothesis generation

  • Absence of clear enzymatic activity or biological pathway association

  • Difficulty in designing targeted functional assays

Research opportunities:

  • Potential to discover novel biological mechanisms in M. tuberculosis

  • Possibility of identifying new virulence factors or drug targets

  • Opportunity for innovative experimental approaches to elucidate function

The conserved nature of this protein across species, combined with its contribution to virulence, suggests evolutionary selection pressure to maintain this gene, indicating functional relevance despite our current knowledge gaps. Recent advances in structural biology, protein-protein interaction studies, and systems biology approaches may help resolve the function of this and other conserved hypothetical proteins in M. tuberculosis.

What techniques can be used to determine the three-dimensional structure of Rv1290c/MT1328?

Several complementary approaches can be employed to determine the three-dimensional structure of Rv1290c:

  • X-ray crystallography: This would require:

    • Cloning the Rv1290c gene into an expression vector with an affinity tag

    • Optimizing conditions for overexpression in E. coli or other host systems

    • Purifying the protein using affinity chromatography and size exclusion

    • Screening for crystallization conditions

    • X-ray diffraction data collection and structure determination

  • Cryo-electron microscopy (cryo-EM): Particularly useful if Rv1290c forms complexes:

    • Sample preparation on grids

    • Vitrification in liquid ethane

    • Data collection using high-end electron microscopes

    • Single-particle analysis and 3D reconstruction

  • NMR spectroscopy: Suitable for smaller domains of the protein:

    • Expression with isotopic labeling (15N, 13C)

    • Multidimensional NMR experiments

    • Chemical shift assignments

    • NOE-based distance restraints for structure calculation

  • Computational structure prediction: Using recent advances in AI-based approaches:

    • AlphaFold2 or RoseTTAFold modeling

    • Molecular dynamics simulations to refine models

    • Integration with sparse experimental data

Since Rv1290c is a relatively large protein (521 amino acids) , a combination of these approaches may be most effective, potentially including the analysis of individual domains separately.

What experimental approaches can be used to identify potential binding partners or substrates of Rv1290c/MT1328?

To identify potential binding partners or substrates of Rv1290c, researchers can employ several complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged Rv1290c in M. tuberculosis or surrogate hosts

    • Perform pull-down experiments under varying conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions with orthogonal methods

  • Bacterial two-hybrid or yeast two-hybrid screening:

    • Use Rv1290c as bait against M. tuberculosis genomic libraries

    • Screen for positive interactions

    • Confirm with co-immunoprecipitation or pull-down assays

  • Proximity-dependent biotin labeling (BioID or TurboID):

    • Fuse Rv1290c to a biotin ligase

    • Express in M. tuberculosis

    • Identify biotinylated proteins in proximity to Rv1290c

    • This approach is particularly valuable for identifying transient interactions

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers to stabilize protein-protein interactions

    • Digest and analyze by mass spectrometry

    • Identify crosslinked peptides to map interaction interfaces

  • Metabolite profiling in wild-type vs. knockout strains:

    • Compare metabolomes of wild-type and Rv1290c knockout strains

    • Identify accumulated or depleted metabolites as potential substrates

    • Validate with in vitro enzymatic assays

These methods could provide crucial insights into the function of Rv1290c by revealing its interaction network within the bacterial cell.

How can transcriptomic and proteomic approaches be used to understand the role of Rv1290c/MT1328 in Mycobacterium tuberculosis?

Integrative -omics approaches can provide systems-level insights into the function of Rv1290c:

  • Comparative transcriptomics:

    • RNA-seq analysis comparing wild-type and Rv1290c knockout strains

    • Identification of differentially expressed genes

    • Analysis under various stress conditions relevant to infection

    • Network analysis to identify affected pathways

  • Quantitative proteomics:

    • Label-free or isotope-labeled quantitative proteomics (e.g., TMT, SILAC)

    • Comparison between wild-type and Rv1290c mutant strains

    • Subcellular fractionation to identify compartment-specific changes

    • Post-translational modification analysis

  • Integrative multi-omics analysis:

    • Correlation of transcriptomic and proteomic datasets

    • Pathway enrichment analysis

    • Protein-protein interaction network mapping

    • Integration with phenotypic data from infection models

  • Condition-dependent expression profiling:

    • Analysis of Rv1290c expression under different infection-relevant conditions

    • Identification of co-regulated genes

    • Inference of potential regulatory networks

Proteomics studies have already identified Rv1290c in the cytosol of M. tuberculosis using 2DLC/MS , providing initial insights into its subcellular localization. Further differential expression studies comparing wild-type and mutant strains could reveal pathways affected by Rv1290c disruption and provide clues to its function.

What is the potential of Rv1290c/MT1328 as a drug target for tuberculosis treatment?

Rv1290c demonstrates several characteristics that make it a potentially attractive drug target:

  • Role in virulence: Mutants lacking Rv1290c show reduced virulence in SCID mice , suggesting targeting this protein could attenuate disease progression.

  • Non-essentiality for in vitro growth: While Rv1290c is non-essential for growth in laboratory conditions , its importance in vivo means drugs targeting it might be effective during actual infection without easily selecting for resistance during in vitro screening.

  • Conservation in mycobacteria: As a conserved protein, inhibitors might be effective against multiple mycobacterial species, including different strains of M. tuberculosis.

  • No human homologs: Based on available information, Rv1290c does not appear to have close human homologs, potentially reducing off-target effects.

Drug discovery approaches for Rv1290c could include:

  • High-throughput screening of compound libraries against purified protein

  • Fragment-based drug design if structural information becomes available

  • Phenotypic screening using Rv1290c overexpression or conditional knockdown strains

  • In silico screening based on predicted binding pockets

The unique position of Rv1290c as a virulence factor rather than an essential gene suggests it could complement existing antibiotics that target essential cellular processes, potentially creating synergistic treatment approaches that both kill bacteria and reduce pathogenicity.

How can genetic engineering techniques be used to further investigate the function of Rv1290c/MT1328?

Advanced genetic engineering techniques offer powerful approaches to investigate Rv1290c function:

  • CRISPR-Cas9 mediated precise genome editing:

    • Introduction of point mutations to identify critical residues

    • Domain deletions to assess functional regions

    • Promoter modifications to study regulation

    • Scarless gene deletion with complementation studies

  • Conditional expression systems:

    • Tetracycline-inducible or repressible promoters

    • Protein degradation tags for rapid depletion

    • CRISPRi for transcriptional repression

    • These approaches overcome limitations of studying genes with potential growth defects in knockout strains

  • Reporter fusions:

    • Fluorescent protein fusions to study localization

    • Split reporter systems to detect protein-protein interactions in vivo

    • Promoter-reporter fusions to study transcriptional regulation

  • Domain swap experiments:

    • Exchange of domains with homologs from related species

    • Creation of chimeric proteins to identify functional regions

    • Complementation studies with corresponding genes from non-virulent mycobacteria

  • Site-directed mutagenesis:

    • Targeted mutation of conserved residues

    • Alanine-scanning mutagenesis

    • Introduction of tags for protein purification and detection

These genetic tools can help establish cause-effect relationships between specific aspects of Rv1290c structure and function in the context of M. tuberculosis virulence and physiology.

What is the relationship between Rv1290c/MT1328 expression and Mycobacterium tuberculosis virulence in different infection models?

The relationship between Rv1290c expression and virulence can be investigated across multiple infection models:

  • Cellular infection models:

    • Comparison of wild-type and Rv1290c mutant strains in:

      • Human primary macrophages

      • THP-1 macrophage-like cells

      • Dendritic cells

      • Lung epithelial cells

    • Assessment of bacterial survival, replication, and host cell responses

  • Animal infection models:

    • SCID mice: Already shown to have reduced virulence with Rv1290c mutants

    • Immunocompetent mouse models: C57BL/6, BALB/c, C3HeB/FeJ

    • Guinea pig model: For granuloma formation and disease progression

    • Non-human primate models: For closer representation of human TB

  • Ex vivo infection models:

    • Human lung tissue explants

    • Precision-cut lung slices

    • 3D organoid cultures

  • Expression analysis during infection:

    • Transcriptional profiling of Rv1290c during different stages of infection

    • Correlation with markers of virulence or stress response

    • Comparison with expression patterns of known virulence factors

Understanding how Rv1290c expression correlates with virulence across these different models could provide insights into its specific role in pathogenesis and identify the conditions under which it is most important for bacterial survival or virulence.

What are the current knowledge gaps regarding Rv1290c/MT1328 and how might they be addressed?

Despite the identification of Rv1290c as a virulence-associated gene, several critical knowledge gaps remain:

  • Molecular function: The biochemical activity of Rv1290c remains unknown. Future research should focus on:

    • Structural studies to identify potential active sites

    • Substrate screening approaches

    • Comparative analysis with distant homologs of known function

  • Regulation: Little is known about how Rv1290c expression is regulated. Approaches to address this include:

    • Promoter analysis and transcription factor binding studies

    • Expression profiling under various stress conditions

    • Epigenetic analysis of the Rv1290c locus

  • Interaction partners: The protein interaction network of Rv1290c remains to be elucidated. This could be addressed through:

    • Comprehensive protein-protein interaction screens

    • Co-immunoprecipitation studies

    • Proximity labeling approaches

  • Mechanistic basis for virulence contribution: How Rv1290c contributes to virulence at the molecular level remains unknown. This could be investigated through:

    • Host response studies comparing wild-type and mutant infections

    • Analysis of host cellular pathways affected by Rv1290c

    • Identification of host targets or binding partners

  • Structure-function relationships: The specific domains or residues critical for Rv1290c function have not been identified. This could be addressed through:

    • Systematic mutagenesis studies

    • Domain deletion analysis

    • Comparative structural modeling

Addressing these knowledge gaps would significantly advance our understanding of this conserved hypothetical protein and its role in M. tuberculosis pathogenesis.

How does the study of Rv1290c/MT1328 contribute to our broader understanding of Mycobacterium tuberculosis pathogenesis?

The study of Rv1290c contributes to our broader understanding of M. tuberculosis pathogenesis in several key ways:

  • Virulence mechanisms: Understanding how non-essential genes like Rv1290c contribute to virulence helps elucidate the complex strategies M. tuberculosis employs during infection. The reduced virulence of Rv1290c mutants in SCID mice suggests it plays a role in host-pathogen interactions rather than basic cellular metabolism.

  • Adaptation to host environments: As a protein that appears important in vivo but not in vitro, Rv1290c likely contributes to adaptation to specific host environments or stress conditions encountered during infection.

  • Novel therapeutic approaches: Identifying virulence factors like Rv1290c expands potential drug targets beyond essential genes, potentially leading to anti-virulence therapies that could complement traditional antibiotics.

  • Evolution of pathogenicity: The conservation of Rv1290c across mycobacterial species provides insights into the evolution of virulence traits within the Mycobacterium genus.

  • Functional genomics: The ongoing characterization of conserved hypothetical proteins like Rv1290c contributes to filling the substantial knowledge gaps in the M. tuberculosis genome, where approximately 25% of genes remain functionally uncharacterized.

By elucidating the function of Rv1290c, researchers can gain insights into previously unrecognized aspects of M. tuberculosis biology, potentially revealing novel vulnerabilities that could be exploited for therapeutic intervention.

What are potential applications of recombinant Rv1290c/MT1328 protein in tuberculosis research and diagnostics?

Recombinant Rv1290c protein could serve multiple applications in tuberculosis research and diagnostics:

  • Immunological studies:

    • Development of antibodies against Rv1290c for research applications

    • Analysis of immune responses to Rv1290c in TB patients

    • Evaluation as a potential biomarker for disease progression or treatment response

  • Structural and functional analysis:

    • In vitro biochemical assays to identify potential enzymatic activities

    • Crystallization and structure determination

    • Protein-protein interaction studies

    • Small molecule binding assays for drug discovery

  • Diagnostic applications:

    • Development of serological assays to detect antibodies against Rv1290c in patient samples

    • Inclusion in antigen panels for T-cell based diagnostic tests

    • Potential component of multiplexed diagnostic platforms

  • Vaccine research:

    • Evaluation as a potential vaccine antigen

    • Study of immune responses to Rv1290c in animal models

    • Component of subunit vaccine formulations

  • Drug target validation:

    • High-throughput screening platform for inhibitor discovery

    • Structure-based drug design

    • Fragment-based drug discovery approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.