Recombinant Uncharacterized protein Rv1319c/MT1361 (Rv1319c, MT1361)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant Uncharacterized Protein Rv1319c/MT1361 is a full-length, membrane-associated protein expressed in E. coli with an N-terminal His-tag for purification . It corresponds to the Rv1319c gene in M. tuberculosis H37Rv and MT1361 in the CDC1551 strain .

ParameterDetails
UniProt IDP0A4Y2
Amino Acid Sequence535 residues (MPAKKTMAQR...PTRLAVPT)
Molecular Weight~60 kDa (estimated from 535 residues)
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE)
TagN-terminal His-tag

Domain Architecture

The protein contains:

  • Guanylate cyclase domain: Implicated in nucleotide cyclase activity .

  • HAMP domain: Mediates signal transduction in bacterial sensors .

  • Class-3 adenylyl cyclase family: Suggests potential enzymatic roles in cyclic nucleotide synthesis .

Subcellular Localization

Predicted to be a multi-pass transmembrane protein localized to the bacterial cell membrane .

Sequence Conservation

Shares homology with adenylyl cyclases across bacterial species, indicating evolutionary conservation of its structural domains .

Primary Uses

  • Protein-protein interaction studies: Investigates binding partners in M. tuberculosis pathogenesis .

  • Structural biology: Serves as a substrate for X-ray crystallography or cryo-EM to resolve 3D conformation .

  • Antigen development: Potential use in antibody generation for diagnostic assays .

Functional Hypotheses and Research Gaps

Despite being "uncharacterized," its domains suggest possible roles in:

  1. Cyclic nucleotide signaling: Guanylate/adenylyl cyclase activity could modulate bacterial cAMP/cGMP levels .

  2. Host-pathogen interactions: Membrane localization may facilitate host cell adhesion or immune evasion .

  3. Signal transduction: HAMP domains often regulate kinase activity in response to environmental stimuli .

Critical Knowledge Gaps:

  • Direct enzymatic activity remains unverified.

  • Interaction networks within M. tuberculosis are undefined.

  • Pathogenic relevance in tuberculosis infection is unexplored.

Future Research Directions

  1. Enzymatic profiling: Test cyclase activity using GTP/ATP substrates.

  2. CRISPR knockouts: Assess phenotypic changes in M. tuberculosis lacking Rv1319c.

  3. Host interactome mapping: Identify human proteins binding to Rv1319c via pull-down assays.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag preference, please inform us, and we will prioritize development of the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Target Names
Rv1319c, MT1361
Target Protein Sequence
MPAKKTMAQRLGQALETMTRQCGQLPETPAYGSWLLGRVSESPSRRWVRIKRIVTVYIMT ANLTGIVVALLVVTFAFPVPSIYTDAPWWVTFGVAPAYATLALAIGTYWITTRIVRASIR WAIEERAPSQADGRNTLLLPFRVAAVHLILWDIGGALLATLYGLANRVFVTIILFSVTIC GVLVATNCYLFTEFALRPVAAKALEAGRPPRRFAPGIMGRTMTVWSLGSGVPVTGIATTA LYVLLVHNLTETQLASAVLILSITTLIFGFLVMWILAWLTAAPVRVVRAALKRVEQGDLR GDLVVFDGTELGELQRGFNAMVNGLRERERVRDLFGRHVGREVAAAAERERPQLGGEDRH AAVVFVDIVGSTQLVDNQPAAHVVKLLNRFFAIVVNEVDRHHGLINKFAGDAALAIFGAP NRLDRPEDAALAAARAIADRLANEMPEVQAGIGVAAGQIVAGNVGAKQRFEYTVVGKPVN QAARLCELAKSHPARLLASSDTLHAASETERAHWSLGETVTLRGHEQPTRLAVPT
Uniprot No.

Q&A

What is Recombinant Uncharacterized Protein Rv1319c/MT1361?

Recombinant Uncharacterized Protein Rv1319c/MT1361 is a full-length protein (535 amino acids) from Mycobacterium tuberculosis that can be expressed with an N-terminal His-tag in E. coli expression systems. The protein is designated by the UniProt ID P0A4Y2 and represents a gene product that varies between different strains of M. tuberculosis. The protein's function remains uncharacterized, though genomic analysis suggests it may function as an adenylate cyclase based on homology comparisons .

The recombinant version typically contains the complete amino acid sequence (1-535) with a histidine tag to facilitate purification. Research indicates that this protein is part of the genetic differences observed between M. tuberculosis clinical isolates, specifically between the laboratory strain H37Rv and the clinical isolate CDC1551 .

What is the genomic context of Rv1319c/MT1361 in different M. tuberculosis strains?

The genomic organization of Rv1319c/MT1361 represents one of the notable differences between M. tuberculosis strains. Whole-genome comparison reveals that strain CDC1551 contains two cyclases (MT1360 and MT1361) between two flanking genes, while strain H37Rv contains only one cyclase (Rv1319c) in the same region . This structural variation suggests potential functional differences between these strains.

This genomic difference is particularly significant as it represents a case of gene duplication or deletion between strains, which could impact cyclase activity and related cellular processes. The complete amino acid sequence of Rv1319c suggests membrane-associated functions, with predicted transmembrane domains that may be involved in signal transduction pathways .

What experimental designs are suitable for studying Rv1319c/MT1361 function?

Given the uncharacterized nature of Rv1319c/MT1361, single-case experimental designs (SCEDs) may be particularly valuable for investigating its function. SCEDs represent a family of research designs that use experimental methods to systematically study treatment effects, which can be adapted to investigate protein function .

For Rv1319c/MT1361, a reversal design approach could be employed where the protein's activity is measured under baseline conditions (A), followed by experimental manipulation (B), and then returning to baseline conditions (A). This ABA design allows researchers to establish experimental control and can be extended to an ABAB design for greater confidence in results .

The design implementation requires:

  • Establishing stable baseline measurements (minimum 5 data points per phase)

  • Introducing experimental manipulations (e.g., substrate addition, inhibitors)

  • Measuring outcomes with sufficient frequency to detect changes

  • Returning to baseline conditions to confirm reversibility of effects

  • Replicating the experimental manipulation to verify reproducibility

This approach can be particularly valuable for characterizing enzymatic activities, protein-protein interactions, or membrane transport functions that Rv1319c/MT1361 might possess .

How can researchers optimize expression and purification of recombinant Rv1319c/MT1361?

Optimizing the expression and purification of recombinant Rv1319c/MT1361 requires careful consideration of several factors:

ParameterRecommendationRationale
Expression SystemE. coli (BL21 DE3 or similar)Proven effective for Rv1319c/MT1361 expression
Induction Conditions0.5-1.0 mM IPTG, 16-18°C, 16-20 hoursReduces inclusion body formation for membrane proteins
Cell LysisSonication or high-pressure homogenization with detergentsEssential for membrane protein solubilization
PurificationNi-NTA affinity chromatography followed by size exclusionLeverages His-tag for initial capture
Buffer ComponentsTris/PBS-based buffer, pH 8.0, with 6% trehaloseMaintains stability during storage
Storage-20°C/-80°C with 50% glycerolPrevents freeze-thaw damage

For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 50% is advised for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles which can compromise protein stability .

What methodological approaches can characterize the biochemical function of Rv1319c/MT1361?

Since MT1361 is potentially an adenylate cyclase based on genomic analysis , several methodological approaches can be employed to characterize its biochemical function:

  • Enzymatic Activity Assays: Using radioisotope-labeled substrates (ATP) to measure cyclase activity by detecting cAMP formation. This can be quantified using:

    • Radioactive assays with [α-32P]ATP

    • ELISA-based cAMP detection kits

    • HPLC analysis of reaction products

  • Site-Directed Mutagenesis: Systematically altering predicted catalytic residues to confirm their role in enzymatic function. This approach would target conserved residues identified through sequence alignment with known adenylate cyclases.

  • Protein-Protein Interaction Studies:

    • Pull-down assays using His-tagged Rv1319c/MT1361

    • Yeast two-hybrid screening

    • Co-immunoprecipitation from mycobacterial extracts

  • Structural Analysis:

    • X-ray crystallography of purified protein

    • Cryo-EM for membrane-associated conformations

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • Membrane Localization Studies:

    • Fractionation of bacterial membranes

    • Fluorescence microscopy with tagged protein variants

    • Protease accessibility assays to determine topology

These approaches, when combined, can provide comprehensive insights into the biochemical function and cellular role of Rv1319c/MT1361.

How do genomic differences between M. tuberculosis strains impact Rv1319c/MT1361 research?

The genomic differences between M. tuberculosis strains have significant implications for Rv1319c/MT1361 research. Analysis revealed that strain CDC1551 contains two cyclases (MT1360 and MT1361), while strain H37Rv contains only one cyclase (Rv1319c) in the same genomic region . This variation necessitates careful experimental design considerations:

  • Strain Selection: Researchers must explicitly state which M. tuberculosis strain they are working with, as results may not be generalizable across strains.

  • Functional Redundancy Analysis: The presence of two cyclases in CDC1551 suggests possible functional redundancy or specialization that should be investigated through:

    • Knockout studies of individual cyclases

    • Double knockout experiments

    • Complementation studies between strains

  • Evolutionary Analysis: Comparative genomics approaches can illuminate:

    • Whether gene duplication or deletion events occurred

    • Selection pressures on these genes

    • Implications for virulence or adaptation

  • Expression Pattern Differences: Transcriptomic analysis can reveal:

    • Differential expression patterns between strains

    • Regulatory mechanisms controlling cyclase expression

    • Condition-specific activation

This strain variation should be viewed as an opportunity to understand the functional significance of cyclase diversity in M. tuberculosis and its potential role in pathogenesis .

What techniques can help resolve the three-dimensional structure of Rv1319c/MT1361?

Resolving the three-dimensional structure of membrane-associated proteins like Rv1319c/MT1361 presents unique challenges. Multiple complementary approaches can be employed:

  • X-ray Crystallography:

    • Requires detergent solubilization and purification

    • Screening of various detergents and crystallization conditions

    • Use of lipidic cubic phase for membrane protein crystallization

    • Resolution typically ranges from 1.5-3.0 Å

  • Cryo-Electron Microscopy:

    • Particularly suitable for membrane proteins

    • Can visualize protein in native-like lipid environments

    • Recent advances allow near-atomic resolution (~2-4 Å)

    • Does not require crystallization

  • NMR Spectroscopy:

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-embedded regions

    • Provides dynamic information not available from static structures

    • Limited to smaller proteins or domains

  • Integrative Modeling Approaches:

    • Combining experimental data with computational methods

    • Homology modeling based on related adenylate cyclases

    • Molecular dynamics simulations to understand membrane interactions

    • Cross-linking mass spectrometry to identify spatial constraints

Each technique provides complementary information, and a multi-method approach is likely to yield the most comprehensive structural understanding of Rv1319c/MT1361.

How can Rv1319c/MT1361 research contribute to understanding M. tuberculosis pathogenesis?

Research on Rv1319c/MT1361 can significantly contribute to understanding M. tuberculosis pathogenesis through several avenues:

  • Signal Transduction Pathways: As a potential adenylate cyclase, Rv1319c/MT1361 may participate in cAMP-dependent signaling pathways that regulate virulence factors. These pathways may influence:

    • Bacterial adaptation to host environments

    • Regulation of metabolism during infection

    • Modulation of host immune responses

  • Strain-Specific Virulence: The presence of an additional cyclase (MT1360) in clinical isolate CDC1551 compared to laboratory strain H37Rv suggests potential adaptations that may affect virulence . This genomic difference can be investigated through:

    • Comparative virulence studies between strains

    • Targeted gene knockout experiments

    • Complementation studies to restore wild-type phenotypes

  • Host-Pathogen Interactions: Membrane-associated proteins like Rv1319c/MT1361 may directly interface with host cells, potentially influencing:

    • Bacterial adhesion to host cells

    • Intracellular survival mechanisms

    • Modulation of phagosome maturation

  • Drug Target Potential: Characterizing Rv1319c/MT1361 function could reveal novel drug targets, especially if the protein is essential for survival or virulence and sufficiently different from human proteins.

What experimental models are appropriate for studying Rv1319c/MT1361 in the context of tuberculosis?

Several experimental models can be employed to study Rv1319c/MT1361 in the context of tuberculosis:

Model TypeApplicationsAdvantagesLimitations
In vitro biochemical assaysEnzymatic characterization, protein interactionsHighly controlled, quantitativeLacks cellular context
Mycobacterial culturesGene knockout studies, complementationNative expression environmentLimited host factor influence
Macrophage infection modelsHost-pathogen interactionsCellular context, phagocytosisSimplified immune environment
Animal models (mouse, guinea pig)In vivo pathogenesis, drug efficacySystemic infection dynamicsSpecies differences from human TB
Human cell/tissue modelsRelevance to human diseaseDirect clinical relevanceEthical and practical limitations

For initial characterization, in vitro approaches with recombinant protein should be complemented with genetic manipulation of M. tuberculosis (both H37Rv and CDC1551 strains). Subsequently, cellular and animal models can provide insights into the protein's role in infection and disease progression.

Single-case experimental designs can be adapted for these models, particularly for interventional studies where baseline measurements, treatment interventions, and return to baseline conditions can be systematically implemented and measured .

How can researchers address the challenges of working with an uncharacterized protein?

Working with uncharacterized proteins like Rv1319c/MT1361 presents unique challenges that require systematic approaches:

  • Bioinformatic Analysis Pipeline:

    • Sequence alignment with characterized proteins

    • Domain prediction and functional motif identification

    • Structural prediction using AlphaFold or similar tools

    • Phylogenetic analysis to identify evolutionary relationships

  • Functional Prediction Testing:

    • Design assays based on predicted functions (e.g., cyclase activity)

    • Screen for activity using substrate libraries

    • Test under various physiological conditions relevant to M. tuberculosis lifecycle

  • Iterative Experimental Design:

    • Begin with broad screening approaches

    • Narrow focus based on initial results

    • Implement reversal experimental designs to confirm findings

    • Require minimum of 5 data points per experimental phase for reliability

  • Collaborative Approaches:

    • Engage structural biologists for protein characterization

    • Partner with mycobacteriologists for in vivo relevance

    • Utilize complementary expertise across disciplines

This systematic approach moves from prediction to validation, gradually building a functional profile of the uncharacterized protein through iterative experimentation and diverse methodologies.

What quality control measures should be applied when working with recombinant Rv1319c/MT1361?

Ensuring quality and consistency in recombinant Rv1319c/MT1361 preparations is critical for reliable research outcomes:

  • Purity Assessment:

    • SDS-PAGE analysis (>90% purity recommended)

    • Mass spectrometry to confirm protein identity

    • Western blot with anti-His antibodies to verify tag integrity

  • Functional Integrity Verification:

    • Circular dichroism to assess secondary structure

    • Thermal shift assays to measure stability

    • Activity assays if function becomes known

  • Storage and Handling Protocol:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Add 50% glycerol for long-term storage

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Lot-to-Lot Consistency:

    • Maintain detailed production records

    • Compare key parameters between batches

    • Include reference standards in critical experiments

  • Environmental Sensitivity Testing:

    • Stability at different temperatures

    • pH sensitivity range

    • Buffer compatibility analysis

What are the current knowledge gaps regarding Rv1319c/MT1361?

Despite the available information on Rv1319c/MT1361, significant knowledge gaps remain that present opportunities for research advancement:

  • Functional Characterization: The precise biochemical function of Rv1319c/MT1361 remains unconfirmed, though genomic context suggests cyclase activity .

  • Structural Information: No three-dimensional structure has been determined for this protein, limiting structure-based functional predictions and drug design efforts.

  • Regulatory Mechanisms: The conditions under which this gene is expressed and the regulatory networks controlling its expression remain undefined.

  • Role in Pathogenesis: The contribution of Rv1319c/MT1361 to M. tuberculosis virulence, persistence, or drug resistance is unknown.

  • Strain Variation Significance: The functional implications of having one versus two cyclases in different M. tuberculosis strains require further investigation .

  • Interaction Partners: The protein-protein interaction network involving Rv1319c/MT1361 remains to be characterized.

Addressing these knowledge gaps through systematic application of the experimental approaches outlined in this FAQ collection would significantly advance our understanding of this protein and potentially contribute to new therapeutic strategies against tuberculosis.

How can researchers integrate findings about Rv1319c/MT1361 into broader tuberculosis research?

Integrating Rv1319c/MT1361 research into the broader tuberculosis research landscape requires strategic approaches:

  • Pathway Integration: Position findings within known M. tuberculosis signaling and metabolic pathways, particularly those involving cAMP signaling.

  • Multi-omics Data Correlation: Correlate protein function with transcriptomic, proteomic, and metabolomic datasets from various infection models and clinical samples.

  • Strain Variation Context: Analyze function in relation to the known genomic differences between clinical and laboratory strains, connecting protein-level findings to strain-specific phenotypes .

  • Drug Resistance Mechanisms: Investigate potential connections between cyclase activity and known drug resistance mechanisms in M. tuberculosis.

  • Experimental Design Standardization: Implement rigorous experimental designs with appropriate controls and replications (minimum three replications) to ensure findings are reproducible and integrable with other research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.