Recombinant Uncharacterized protein Rv1342c/MT1383 (Rv1342c, MT1383)

Shipped with Ice Packs
In Stock

Description

Official Nomenclature

The protein is officially designated as "Uncharacterized protein Rv1342c/MT1383 (Rv1342c, MT1383)" .

Basic Information

FeatureDetails
Full LengthFull Length (1-120)
SourceMycobacterium tuberculosis
HostE. coli
TagHis-Tagged
Protein Length120 amino acids
Molecular WeightApproximately 13 kDa
UniProt No.P0A5E7
Gene NamesRv1342c, MT1383
ORF NamesMTCY02B10.06c
Expression Region1-120

Function

The precise biochemical function of Rv1342c/MT1383 is currently undetermined, classifying it as an uncharacterized protein . Research indicates that it participates in various pathways and performs multiple roles, potentially in conjunction with other proteins .

Interactions

Rv1342c/MT1383 interacts directly with different proteins and molecules, as identified through methods like yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays .

Involvement in Pathways

Rv1342c/MT1383 is involved in several pathways, implying its diverse roles within the cell . The specific details of these pathways can be found at Creative BioMart .

Expression and Purification

Rv1342c/MT1383 is expressed as a recombinant protein in E. coli and can be purified using its His-tag .

Potential as a Diagnostic Marker

Proteins like Rv1342c/MT1383 are explored as potential diagnostic markers for tuberculosis, particularly in distinguishing between active and latent infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Target Names
Rv1342c, MT1383
Target Protein Sequence
MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL
Uniprot No.

Q&A

What is Rv1342c/MT1383?

Rv1342c/MT1383 is a conserved membrane protein encoded by the Rv1342c gene in Mycobacterium tuberculosis H37Rv. It consists of 120 amino acids and is highly conserved across mycobacterial strains, indicating its potential functional importance. Proteomics studies have confirmed its presence in the membrane fraction of M. tuberculosis H37Rv through nanoLC-MS/MS analysis, and it has been identified as a predicted integral membrane protein . The protein shares significant homology (68.3% identity over 120 amino acids) with a hypothetical protein B1549_F2_59 from Mycobacterium leprae, suggesting conservation of function across pathogenic mycobacteria .

What is known about the functional significance of Rv1342c/MT1383?

While Rv1342c/MT1383 remains functionally uncharacterized, genetic studies have demonstrated its essentiality for mycobacterial growth. Disruption of this gene results in significant growth defects of M. tuberculosis H37Rv in vitro, as confirmed by saturated Himar1 transposon library analyses . Sassetti et al. (2003) identified it as an essential gene through Himar1 transposon mutagenesis in the H37Rv strain . Its classification under the functional category of "Cell wall and cell processes" and its integral membrane protein nature suggest it may play a critical role in cell envelope integrity or membrane transport functions, making it potentially significant for bacterial survival and pathogenesis .

What are the optimal purification strategies for recombinant Rv1342c/MT1383?

For His-tagged Rv1342c/MT1383, a multi-step purification protocol is recommended. Following cell lysis, initial purification via nickel affinity chromatography can be performed using a Tris/PBS-based buffer system at pH 8.0 . Further purification may be achieved through size exclusion chromatography to remove aggregates and obtain a homogeneous protein preparation. Final purification products should achieve greater than 90% purity as determined by SDS-PAGE analysis . For membrane protein purification, inclusion of appropriate detergents such as those used in Triton X-114 extractions, which have successfully identified this protein in previous studies, may be necessary to maintain solubility and native conformation .

What are the critical considerations for storage and stability of purified Rv1342c/MT1383?

Purified recombinant Rv1342c/MT1383 is typically provided as a lyophilized powder to ensure long-term stability . For optimal storage, the protein should be kept at -20°C to -80°C, with aliquoting strongly recommended to avoid repeated freeze-thaw cycles that can lead to protein degradation and loss of activity . When reconstituting the lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% (with 50% being most commonly used) is recommended for aliquots intended for long-term storage . For working stocks, storing aliquots at 4°C is suitable for up to one week, but extended periods at this temperature should be avoided .

How can Rv1342c/MT1383 be utilized in tuberculosis drug discovery pipelines?

As an essential membrane protein in Mycobacterium tuberculosis, Rv1342c/MT1383 represents a promising target for novel anti-tuberculosis therapeutics. Research approaches might include structure-based drug design, following determination of the protein's three-dimensional structure through X-ray crystallography or cryo-electron microscopy. High-throughput screening assays can be developed using the purified recombinant protein to identify small molecule inhibitors that disrupt its function . Since disruption of this gene results in growth defects in vitro, compounds that effectively target this protein may demonstrate bacteriostatic or bactericidal activity against M. tuberculosis . Additionally, researchers might employ computational approaches such as molecular docking studies to identify potential binding sites and design targeted inhibitors, particularly focusing on regions of the protein that are highly conserved across mycobacterial species but distinct from human proteins.

What experimental approaches can elucidate the membrane topology of Rv1342c/MT1383?

Understanding the membrane topology of Rv1342c/MT1383 is crucial for functional characterization. Several complementary experimental approaches can be employed. Protease protection assays using recombinant protein reconstituted in liposomes can identify exposed regions. Site-directed cysteine labeling combined with mass spectrometry can map transmembrane segments. Computational prediction algorithms should be validated with experimental data from techniques such as PhoA or GFP fusion libraries, where fusion constructs at different positions along the protein sequence can reveal cytoplasmic versus periplasmic orientation of specific domains . Fluorescence resonance energy transfer (FRET) analysis with domain-specific antibodies or ligands can provide additional insights into spatial relationships between different regions of the protein within the membrane context.

What functional assays might reveal the physiological role of Rv1342c/MT1383?

Given the current uncharacterized status of Rv1342c/MT1383, several functional assays can be employed to elucidate its physiological role. Bacterial two-hybrid or co-immunoprecipitation studies could identify protein interaction partners, potentially placing it within established cellular pathways . Conditional gene knockout systems, such as tetracycline-regulated expression, could allow for controlled depletion of the protein while monitoring changes in cell envelope properties, metabolism, or stress responses. Lipidomic and metabolomic profiling of conditional mutants might reveal altered membrane composition or metabolic signatures. Since the protein has been identified in Triton X-114 extracts, assessing membrane permeability, small molecule transport, or ion flux in reconstituted proteoliposomes containing purified Rv1342c/MT1383 could reveal potential transport functions . Comparative transcriptomic analyses of wild-type versus depleted strains might also identify regulatory networks affected by this protein.

What structural prediction methods are most appropriate for membrane proteins like Rv1342c/MT1383?

For membrane proteins like Rv1342c/MT1383, a multi-faceted structural prediction approach is recommended. Traditional homology modeling may have limited utility due to the relatively low sequence homology with proteins of known structure. Instead, researchers should employ specialized membrane protein prediction algorithms that account for hydrophobicity patterns and evolutionary conservation . AlphaFold2 and RoseTTAFold have demonstrated significant advancements in predicting membrane protein structures with high accuracy. These predictions should be validated through experimental approaches such as circular dichroism spectroscopy to determine secondary structure content, particularly the alpha-helical components typical of transmembrane domains. Cross-linking mass spectrometry can provide distance constraints to refine computational models. Additionally, molecular dynamics simulations in membrane environments can help assess the stability and conformational dynamics of predicted structures, offering insights into potential functional mechanisms.

What crystallization strategies have been successful for similar mycobacterial membrane proteins?

Crystallization of mycobacterial membrane proteins has historically been challenging but several strategies have proven successful. Detergent screening is critical, with n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucoside (OG), and lauryl maltose neopentyl glycol (LMNG) frequently yielding stable membrane protein preparations suitable for crystallization. Lipidic cubic phase (LCP) crystallization has emerged as a particularly powerful method for obtaining high-resolution structures of mycobacterial membrane proteins. Engineering approaches including truncation of disordered regions, fusion with crystallization chaperones such as T4 lysozyme or BRIL (thermostabilized apocytochrome b562), and introduction of thermostabilizing mutations can significantly improve crystallization outcomes. For Rv1342c/MT1383 specifically, its relatively small size (120 amino acids) may require careful optimization of construct design to ensure stability during purification and crystallization processes .

How conserved is Rv1342c/MT1383 across mycobacterial species?

Rv1342c/MT1383 demonstrates significant conservation across mycobacterial species, suggesting evolutionary importance. It has been identified as a core mycobacterial gene through macro-array and bioinformatic analyses conducted by Marmiesse et al. (2004) . The protein shows high similarity to the hypothetical protein B1549_F2_59 from Mycobacterium leprae, with FASTA scores optimized at 544, E()-value of 1.9e-29, and 68.3% identity across the 120-amino acid overlap . This high degree of conservation between M. tuberculosis and M. leprae is particularly noteworthy since M. leprae has undergone extensive genome reduction during its evolution, retaining primarily essential genes. The conservation pattern suggests that Rv1342c/MT1383 likely performs a fundamental role in mycobacterial physiology rather than a species-specific specialized function. Comparative genomic analyses across broader mycobacterial species, including non-pathogenic mycobacteria, could provide further insights into whether this protein is specifically associated with pathogenicity or represents a core component of mycobacterial cell envelope biology.

What can sequence analysis reveal about functional domains in Rv1342c/MT1383?

Detailed sequence analysis of Rv1342c/MT1383 can provide valuable insights into potential functional domains despite its currently uncharacterized status. Hydropathy plot analysis would identify transmembrane segments, consistent with its classification as an integral membrane protein . Multiple sequence alignment across diverse mycobacterial homologs can reveal highly conserved residues that may be critical for function. Protein family (Pfam) database searches may identify conserved domains or motifs shared with proteins of known function. If conventional homology searches fail to identify clear functional domains, more sensitive profile-based methods like HHpred might detect remote homologies to characterized protein families. Analysis of charged or polar residues within predicted transmembrane segments could indicate potential roles in ion conductance or substrate recognition if the protein functions as a transporter. Conservation analysis in the context of predicted three-dimensional structure could identify surface patches of highly conserved residues that might represent interaction interfaces with other proteins or substrates.

How does Rv1342c/MT1383 compare to homologous proteins in non-pathogenic mycobacteria?

Comparative analysis between Rv1342c/MT1383 and its homologs in non-pathogenic mycobacteria (such as Mycobacterium smegmatis) could provide valuable insights into potential roles in virulence versus general mycobacterial physiology . If sequence conservation is higher in pathogenic species compared to environmental mycobacteria, this might suggest specialization for host-pathogen interactions. Conversely, if conservation is uniform across pathogenic and non-pathogenic species, this would support a fundamental housekeeping role. Expression pattern analysis under different growth conditions in pathogenic versus non-pathogenic species might reveal differential regulation indicative of specialized functions. Genetic complementation experiments, where the homolog from a non-pathogenic species is expressed in an Rv1342c-depleted M. tuberculosis strain, could determine functional equivalence. Co-evolution analysis with other proteins might also reveal whether Rv1342c/MT1383 participates in species-specific protein interaction networks or conserved multiprotein complexes shared across the mycobacterial genus.

What cell-free expression systems are most suitable for Rv1342c/MT1383 production?

Cell-free expression systems offer significant advantages for producing membrane proteins like Rv1342c/MT1383, especially when traditional in vivo systems present challenges with toxicity, inclusion body formation, or low yields . For optimal production, wheat germ extract systems have demonstrated success with mycobacterial membrane proteins due to their ability to support correct folding of complex proteins. These systems can be supplemented with nanolipoprotein particles or detergent micelles to facilitate proper membrane protein folding. E. coli-based cell-free systems offer higher yields but may require optimization of redox conditions and chaperone supplementation. The PURE (Protein synthesis Using Recombinant Elements) system provides a defined environment that can be precisely controlled and modified, potentially beneficial for functional studies requiring specific cofactors or lipid environments. When designing cell-free expression constructs for Rv1342c/MT1383, codon optimization should be considered, along with inclusion of stabilizing elements like the T7 terminator to enhance mRNA stability and translation efficiency .

What reporter systems could effectively monitor Rv1342c/MT1383 expression in mycobacteria?

Developing effective reporter systems to monitor Rv1342c/MT1383 expression in mycobacteria requires careful consideration of the protein's membrane localization and potential functional constraints. Translational fusions with fluorescent proteins like mCherry or mEmerald at either the N- or C-terminus could allow visualization of expression and localization patterns, though care must be taken to ensure the fusion does not disrupt membrane insertion or function. Split fluorescent protein systems, where a small tag is fused to Rv1342c/MT1383 and complemented by a separately expressed fragment, might minimize functional interference while providing quantifiable signals. Luciferase-based reporters placed downstream of the Rv1342c promoter would allow monitoring of transcriptional regulation without altering the protein structure. For studies requiring minimal perturbation of the native protein, epitope tagging with small sequences (FLAG, HA, or His6) followed by immunodetection offers a less disruptive alternative. The essential nature of Rv1342c suggests that reporter fusions should be validated for functionality by complementation testing in conditional knockout strains .

What are appropriate negative and positive controls for functional studies of Rv1342c/MT1383?

Rigorous experimental design for functional characterization of Rv1342c/MT1383 requires appropriate controls. For negative controls, researchers should consider: (1) A vector-only expression system to account for effects of expression stress; (2) Expression of an unrelated membrane protein of similar size to control for general membrane protein overexpression effects; (3) Site-directed mutants targeting predicted critical residues to demonstrate specificity of function; and (4) Conditional knockdown strains with and without inducer to establish phenotypic baselines. For positive controls, researchers might use: (1) Well-characterized membrane proteins from the same functional category (cell wall and cell processes) with known phenotypes; (2) Complementation with wild-type Rv1342c to verify restoration of function in knockout or knockdown strains; and (3) The M. leprae homolog (with 68.3% identity) to assess functional conservation . Additionally, when developing activity assays, including control reactions with heat-inactivated protein can help distinguish enzymatic activity from non-specific effects.

How should discrepancies in experimental results with Rv1342c/MT1383 be addressed?

When encountering discrepancies in experimental results with Rv1342c/MT1383, researchers should implement a systematic troubleshooting approach. First, verify protein identity through mass spectrometry analysis, confirming the correct sequence matches the expected 120-amino acid profile of Rv1342c/MT1383 . Assess protein quality through multiple methods including SDS-PAGE, size exclusion chromatography, and dynamic light scattering to ensure preparation homogeneity and absence of aggregation. Consider the impact of different expression systems (E. coli, yeast, baculovirus, mammalian, or cell-free) on protein folding and post-translational modifications that might affect function . Examine experimental conditions closely, particularly buffer compositions, detergent selection, and lipid environments which can dramatically influence membrane protein behavior. For in vivo studies, genetic background differences between laboratory strains could introduce variables affecting phenotypic outcomes. Statistical analysis should include sufficient biological replicates (minimum n=3) and appropriate statistical tests based on data distribution. When publishing seemingly contradictory results, transparently discuss methodological differences that might explain discrepancies with previous literature.

What bioinformatic pipelines are most appropriate for analyzing Rv1342c/MT1383 structural predictions?

For comprehensive structural analysis of Rv1342c/MT1383, a multi-tiered bioinformatic pipeline is recommended. Begin with transmembrane topology prediction using consensus approaches that combine multiple algorithms (TMHMM, MEMSAT, TOPCONS) to identify potential membrane-spanning regions, consistent with its characterization as an integral membrane protein . Apply specialized tools for beta-barrel versus alpha-helical structure discrimination, though alpha-helical structures are more common in mycobacterial membrane proteins. For tertiary structure modeling, employ state-of-the-art deep learning approaches like AlphaFold2 or RoseTTAFold, which have demonstrated success with membrane proteins. These models should be refined through molecular dynamics simulations in explicit membrane environments using force fields optimized for membrane proteins. Validation metrics should include DOPE scores, Ramachandran plot analysis, and ProSA Z-scores. Functional site prediction can be performed using tools like ConSurf to identify evolutionarily conserved residues, CASTp for pocket detection, and molecular docking simulations to identify potential ligand binding sites. Integration of proteomics data, particularly from studies that have identified Rv1342c/MT1383 in membrane fractions, can provide experimental constraints to improve model accuracy .

How can transcriptomic data be used to understand the regulatory context of Rv1342c/MT1383?

Transcriptomic data can provide valuable insights into the regulatory networks governing Rv1342c/MT1383 expression and its potential functional associations. Researchers should analyze RNA-seq datasets across various growth conditions, stress responses, and infection models to identify correlation patterns with known functional pathways. Co-expression network analysis might reveal genes with similar expression profiles, potentially indicating functional relationships or shared regulatory mechanisms. Comparison with transcriptional regulatory network models for M. tuberculosis could identify potential transcription factors controlling Rv1342c expression. Time-course transcriptomic studies during infection or under stress conditions can reveal dynamic expression patterns that hint at functional roles during specific phases of the bacterial life cycle. Integrating transcriptomic data with available ChIP-seq datasets for M. tuberculosis transcription factors might identify direct regulatory interactions. Comparative transcriptomic analysis between wild-type strains and Rv1342c conditional mutants could reveal downstream effects of Rv1342c depletion, providing clues to its functional role in cellular processes . When analyzing such data, researchers should employ appropriate normalization methods and statistical frameworks specifically designed for mycobacterial transcriptomic analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.