Recombinant Uncharacterized protein Rv1343c/MT1384 (Rv1343c, MT1384)

Shipped with Ice Packs
In Stock

Description

Definition and Gene Information

Recombinant Uncharacterized Protein Rv1343c/MT1384 is encoded by the rv1343c or mt1384 gene in M. tuberculosis. The protein spans 126 amino acids (1–126 residues) and is identified by the UniProt accession number Q11013 . While some sources incorrectly list its species as Homo sapiens (human) , this is likely an error, as the gene originates from M. tuberculosis .

Gene InformationDetails
Gene NamesRv1343c, MT1384
UniProt IDQ11013
Expression Region1–126 amino acids
Source OrganismMycobacterium tuberculosis

Production and Quality Control

The protein is produced via recombinant DNA technology in E. coli, leveraging codon optimization and fusion tags for solubility and purification. Quality control measures include:

  • Purification: Affinity chromatography using the His-tag .

  • Purity Assessment: SDS-PAGE to confirm >90% purity .

  • Stability: Lyophilized form stabilizes the protein for long-term storage at -20°C/-80°C .

Handling RecommendationsDetails
Reconstitution0.1–1.0 mg/mL in deionized water
Glycerol Addition5–50% (final concentration) for stability
Freeze-Thaw CyclesAvoid repeated cycles

Potential Research Applications

While no peer-reviewed studies directly link this protein to specific functions, its role in M. tuberculosis suggests potential applications:

  • Tuberculosis Pathogenesis: As a hypothetical virulence factor, it may contribute to bacterial survival or immune evasion.

  • Diagnostic Targets: Could serve as an antigen in TB diagnostics or vaccine development.

  • Structural Biology: Full-length production enables studies of tertiary structure and interactions with host proteins .

Note: Current literature lacks experimental evidence for these applications, as the protein remains functionally uncharacterized .

Challenges and Considerations

  • Functional Ambiguity: The "uncharacterized" designation reflects limited experimental data on its biological role .

  • Species Misannotation: Inconsistent species labeling in some catalogs (e.g., "Human") necessitates cross-verification.

  • Stability: Repeated freeze-thaw cycles degrade activity, requiring aliquoting for multiple uses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize the development of specified tag types upon request; please inform us of your specific requirements.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Target Names
Rv1343c, MT1384
Target Protein Sequence
MSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAY RNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARK QNRTTA
Uniprot No.

Q&A

What expression system is most suitable for producing recombinant Rv1343c/MT1384?

Basic Research Answer:
Escherichia coli remains the expression system of choice for initial attempts at producing Rv1343c/MT1384. The BL21(DE3) strain, which contains the λDE3 prophage with T7 RNA polymerase under the control of the lacUV5 promoter, provides a robust platform for heterologous protein expression . For Rv1343c/MT1384, consider these specific approaches:

  • Use the pET vector system with the T7 promoter, which can achieve protein expression levels up to 50% of total cellular protein under optimal conditions

  • Include a histidine tag or other affinity tag to facilitate purification

  • Initial expression trials should test multiple temperatures (16°C, 25°C, 37°C) to identify conditions that maximize soluble protein yield

If expression in E. coli proves challenging, consider specialized strains like C41(DE3) or C43(DE3), which were specifically selected to withstand the expression of potentially toxic proteins .

How can codon optimization improve the expression of Rv1343c/MT1384?

Advanced Research Answer:
Codon optimization is critical for expressing mycobacterial proteins in E. coli due to substantial differences in codon usage between these organisms. For Rv1343c/MT1384 specifically:

  • Analyze the Codon Adaptation Index (CAI) of the native sequence and identify rare codons

  • Optimize the sequence using one of several available algorithms that adapt the codon usage to E. coli preferences without altering the amino acid sequence

  • Pay special attention to clusters of rare codons, which can cause ribosomal stalling and premature translation termination

  • Consider co-expression with plasmids providing rare tRNAs (e.g., pRARE plasmid) as an alternative to full codon optimization

Research shows that codon optimization can increase protein yields by 5-15 fold for mycobacterial proteins, potentially turning a failed expression attempt into a successful one.

What is the significance of the C126S mutation sometimes used in recombinant proteins?

Basic Research Answer:
While not specifically documented for Rv1343c/MT1384, the C126S mutation strategy seen in other recombinant proteins like IL-2 provides important insights. In IL-2, this mutation involves substituting serine for cysteine at position 126 . This type of mutation typically serves to:

  • Prevent unwanted disulfide bond formation

  • Reduce protein aggregation during expression and purification

  • Increase protein stability in solution

  • Potentially improve biological activity by eliminating non-native disulfide bonding

For uncharacterized proteins like Rv1343c/MT1384, conducting a computational analysis to identify potentially problematic cysteine residues and testing targeted mutations (like C→S) represents a rational approach to improving recombinant protein production.

What purification strategy should I use for recombinant Rv1343c/MT1384?

Basic Research Answer:
A multi-step purification strategy is recommended for Rv1343c/MT1384:

  • Initial Capture: If using a His-tagged construct, employ immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Intermediate Purification: Remove contaminants with ion exchange chromatography based on the theoretical isoelectric point (pI) of Rv1343c/MT1384

  • Polishing Step: Size exclusion chromatography to achieve high purity and assess oligomeric state

For each step, optimize buffer conditions (pH, salt concentration, reducing agents) to maintain protein stability and solubility. Consider including protease inhibitors during initial lysis steps to prevent degradation.

How can I assess the proper folding of recombinant Rv1343c/MT1384?

Advanced Research Answer:
Assessing proper folding is critical for functional studies of uncharacterized proteins. For Rv1343c/MT1384, employ multiple complementary techniques:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV (190-250 nm) to determine secondary structure content

    • Near-UV (250-350 nm) to assess tertiary structure fingerprint

  • Thermal Shift Assay (TSA):

    • Determine the melting temperature (Tm) as an indicator of stability

    • Screen buffer conditions that maximize thermal stability

  • Limited Proteolysis:

    • Compare digestion patterns of the recombinant protein with those of native protein (if available)

    • Properly folded proteins typically show distinct, limited digestion patterns

  • Intrinsic Fluorescence:

    • Measure tryptophan/tyrosine fluorescence to assess tertiary structure

    • Compare emission spectra under native and denaturing conditions

The combination of these techniques provides strong evidence for proper folding, which is a prerequisite for functional studies.

What approaches can be used to determine if Rv1343c/MT1384 contains disulfide bonds?

Advanced Research Answer:
Determining the presence and configuration of disulfide bonds is crucial for understanding protein structure and function. For Rv1343c/MT1384, implement the following methodology:

  • Computational Prediction:

    • Analyze the amino acid sequence to identify cysteine residues

    • Use algorithms to predict potential disulfide bonds based on spacing and conservation

  • Experimental Verification:

    MethodProcedureData Analysis
    Mass SpectrometryCompare peptide masses under reducing/non-reducing conditionsMass shifts of 2 Da per disulfide bond
    Ellman's ReagentQuantify free thiols in native vs. denatured statesDifference indicates disulfide-bonded cysteines
    SDS-PAGE MobilityCompare migration with/without reducing agentFaster migration in non-reducing conditions suggests disulfides
  • Functional Impact Testing:

    • Generate cysteine-to-serine mutants for each cysteine residue

    • Compare stability and activity of mutants to wild-type protein

For recombinant expression in E. coli, consider using specialized strains like Origami™ that have mutations in thioredoxin reductase (trxB) and glutathione reductase genes to enhance disulfide bond formation in the cytoplasm .

What initial experiments should be conducted to characterize the function of uncharacterized Rv1343c/MT1384?

Basic Research Answer:
Initial functional characterization of Rv1343c/MT1384 should follow a systematic approach:

  • Bioinformatic Analysis:

    • Sequence homology searches using BLAST and HHPred

    • Domain prediction using InterPro and PFAM

    • Structural prediction using AlphaFold2 or RoseTTAFold

  • Expression Analysis:

    • Determine expression levels under different growth conditions

    • Assess expression during infection models

    • Use quantitative RT-PCR with appropriate primers for accurate measurements

  • Protein-Protein Interaction Screening:

    • Pull-down assays using the purified recombinant protein

    • Bacterial two-hybrid system screening

    • Co-immunoprecipitation with anti-Rv1343c antibodies

  • Knockout/Knockdown Studies:

    • Generate knockout strains using homologous recombination

    • Assess phenotypic changes in growth, morphology, and virulence

These approaches provide a foundation for hypothesis generation about the protein's function, which can then be tested with more specific experiments.

How can structural studies help elucidate the function of Rv1343c/MT1384?

Advanced Research Answer:
Structural biology provides critical insights into protein function, especially for uncharacterized proteins. For Rv1343c/MT1384, pursue the following structural approaches:

  • X-ray Crystallography:

    • Conduct crystallization trials using sparse matrix screening

    • Optimize promising crystallization conditions

    • Collect diffraction data and solve the structure

    • Analyze structural features for functional clues

  • Cryo-Electron Microscopy:

    • Particularly valuable if Rv1343c forms larger complexes

    • Provides structural information in a more native-like environment

    • Can reveal conformational heterogeneity

  • NMR Spectroscopy:

    • For dynamic regions or smaller domains

    • Identify residues involved in ligand binding

    • Map protein-protein interaction surfaces

  • Structure-Based Function Prediction:

    ApproachMethodologyExpected Outcome
    Active Site IdentificationStructural analysis of pockets and conservationPotential enzymatic function
    Structural HomologyComparison with known structuresFunctional annotation transfer
    Molecular DockingIn silico screening of metabolite librariesPotential ligands or substrates
    Electrostatic Surface AnalysisCalculate surface charge distributionPrediction of interaction partners

Combined with biochemical validation, these structural approaches can significantly accelerate functional characterization of this uncharacterized protein.

What are the challenges in expressing mycobacterial proteins in heterologous systems?

Advanced Research Answer:
Expressing mycobacterial proteins like Rv1343c/MT1384 in heterologous systems presents several specific challenges:

  • Codon Usage Bias:

    • Mycobacterial genomes have a high GC content (~65%)

    • This creates significant codon usage differences compared to E. coli

    • Solution: Use codon-optimized synthetic genes or co-express rare tRNAs

  • Post-Translational Modifications:

    • Mycobacterial proteins may require specific modifications absent in E. coli

    • Solution: Consider eukaryotic expression systems or cell-free systems for certain applications

  • Protein Folding:

    • The cytoplasmic environment differs between mycobacteria and E. coli

    • Solution: Test expression in specialized E. coli strains like SHuffle® that have altered redox environments

  • Protein Toxicity:

    • Some mycobacterial proteins may be toxic to the host cell

    • Solution: Use tightly controlled expression systems and strains specifically selected to tolerate toxic proteins, such as C41(DE3) or C43(DE3)

  • Solubility Issues:

    • High hydrophobicity or unusual structural features may cause aggregation

    • Solution: Express as fusion proteins with solubility-enhancing tags (MBP, SUMO, TrxA)

Addressing these challenges requires an iterative optimization approach, testing multiple expression conditions and constructs to achieve successful production of functional protein.

How can transcriptomics help understand the role of Rv1343c/MT1384 in M. tuberculosis?

Advanced Research Answer:
Transcriptomic approaches provide valuable insights into the regulation and functional context of Rv1343c/MT1384:

  • RNA-Seq Analysis:

    • Compare expression profiles between wild-type and Rv1343c knockout strains

    • Identify co-regulated genes that may function in the same pathway

    • Use real-time PCR validation for specific targets with appropriate controls

  • Condition-Specific Expression:

    • Analyze expression patterns under different stress conditions (hypoxia, nutrient starvation, low pH)

    • Determine expression changes during host infection

    • Correlate expression with specific growth phases

  • Regulon Mapping:

    • Identify potential transcription factors controlling Rv1343c expression

    • Perform chromatin immunoprecipitation (ChIP-seq) to map regulatory interactions

    • Use reporter assays to validate regulatory elements

  • Transcriptome-Wide Binding Studies:

    • If Rv1343c/MT1384 is suspected to interact with RNA, perform RNA immunoprecipitation (RIP)

    • Analyze RIP-seq data to identify binding motifs and targets

    • Validate interactions using in vitro binding assays

A comprehensive transcriptomic analysis provides a systems-level understanding of Rv1343c/MT1384's role and guides further functional studies.

What high-throughput screening approaches can identify inhibitors of Rv1343c/MT1384?

Advanced Research Answer:
Developing inhibitors for Rv1343c/MT1384 requires established high-throughput screening (HTS) methodologies:

  • Assay Development:

    • Design activity assays based on predicted function

    • Optimize for 384 or 1536-well format

    • Validate with known controls and determine Z'-factor

  • Compound Library Selection:

    Library TypeAdvantagesConsiderations
    Diversity-basedBroad chemical space coverageLower hit rates
    Fragment-basedHigher hit rates, smaller compoundsWeaker initial binding
    FDA-approved drugsRepurposing potential, known safetyLimited novelty
    Natural productsNovel scaffolds, evolved bindingComplex chemistry
  • Screening Methodologies:

    • Biochemical assays measuring direct inhibition

    • Thermal shift assays to detect binding

    • Cellular assays in M. tuberculosis or surrogate systems

    • Structure-based virtual screening if structure is available

  • Hit Validation and Optimization:

    • Confirm activity with fresh compounds

    • Determine structure-activity relationships

    • Assess selectivity against human homologs

    • Optimize pharmacokinetic properties

The development of specific inhibitors not only provides potential therapeutic leads but also serves as chemical probes to further understand the function of Rv1343c/MT1384 in vivo.

How can I troubleshoot low expression yields of Rv1343c/MT1384?

Basic Research Answer:
Low expression yields of Rv1343c/MT1384 can be addressed through systematic troubleshooting:

  • Optimize Induction Conditions:

    • Test different inducer concentrations (0.1-1.0 mM IPTG for T7 systems)

    • Vary induction temperature (16°C, 25°C, 30°C)

    • Try different induction durations (3h, 6h, overnight)

  • Modify Expression Constructs:

    • Try different affinity tags (His, GST, MBP, SUMO)

    • Test tag placement (N-terminal vs. C-terminal)

    • Consider expressing domains separately if full-length protein is problematic

  • Change Expression Strains:

    • Move from BL21(DE3) to specialized strains like Rosetta (for rare codons) or SHuffle (for disulfide bonds)

    • Try C41(DE3) or C43(DE3) strains that better tolerate toxic proteins

    • Consider K-12 derivatives like HMS174, which has improved plasmid stability due to the recA mutation

  • Adjust Growth Media:

    • Compare expression in rich media (LB, TB) vs. minimal media

    • Add glucose to reduce basal expression from leaky promoters

    • Include specific additives (glycine betaine, sorbitol) to improve protein folding

  • Consider Secretion Strategies:

    • Target protein to periplasm using Sec-dependent pathway

    • Use signal peptides like PelB, OmpA, or MalE to direct secretion

By systematically testing these variables, researchers can often transform poor expression into yields sufficient for further characterization.

What quality control measures are essential for recombinant Rv1343c/MT1384 research?

Advanced Research Answer:
Rigorous quality control is critical for ensuring reliable and reproducible research with Rv1343c/MT1384:

  • Identity Verification:

    • Mass spectrometry analysis (peptide mass fingerprinting)

    • N-terminal sequencing

    • Western blot with specific antibodies

  • Purity Assessment:

    • SDS-PAGE with densitometry (aim for >95% purity)

    • High-performance liquid chromatography (HPLC)

    • Capillary electrophoresis

  • Homogeneity Analysis:

    • Dynamic light scattering (DLS) to detect aggregation

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation (AUC)

  • Functional Integrity:

    • Activity assays based on predicted function

    • Ligand binding assays

    • Structural integrity verification by circular dichroism

  • Regulatory Documentation:

    • Safety data sheets (SDS) should be created and maintained

    • Detailed protocols for production and testing

    • Record lot-to-lot variation and consistency

Implementing these quality control measures ensures that experimental results are attributable to the protein of interest rather than contaminants or degraded material, thereby increasing research reliability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.