Recombinant Uncharacterized protein Rv1357c/MT1400 (Rv1357c, MT1400)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Protein Rv1357c/MT1400 (Rv1357c, MT1400)

Mycobacterium tuberculosis (Mtb) poses a significant global health challenge, with approximately one-third of the world's population infected . A key factor contributing to this high infection rate is Mtb's ability to enter a dormant state known as non-replicating persistence, allowing it to survive the host's immune response and persist for many years before potentially re-emerging as an active infection . In this dormant state, protein synthesis is significantly reduced, and the bacteria utilize host lipids as a carbon source, exhibiting resistance to current drugs .

The Recombinant Uncharacterized protein Rv1357c/MT1400 (Rv1357c, MT1400) is a protein associated with Mycobacterium tuberculosis . Genes like Rv1738 are highly upregulated under conditions that mimic the onset of dormancy, such as hypoxia and exposure to nitric oxide, suggesting their importance in the persistence of Mtb .

Rv1357c/BCG1419c as a Cyclic Di-GMP Phosphodiesterase

Rv1357c, also known as BCG1419c in Mycobacterium bovis BCG, functions as a cyclic di-GMP phosphodiesterase (PDE) . Cyclic di-GMP (c-di-GMP) is a second messenger molecule involved in various bacterial processes, including biofilm formation, virulence, and adaptation to environmental stresses . Mycobacteria have limited genes to control biofilm production, but deleting or expressing the c-di-GMP PDE gene can result in changes in pellicle production, protein profiles, lipid production, resistance to nitrosative stress, and maintenance in the host . Pellicle production and the capacity to remain within the host are linked in BCG .

Role in Virulence and Potential as a Drug Target

Proteins secreted by Mtb and their relationship with infection and virulence factors may lead to the development of new anti-TB drugs . Exported repetitive protein (Erp) is a key protein involved in Mtb virulence, binding to Rv1417 and Rv2617c proteins . Disrupting these interactions could alter Erp's function and reduce Mtb's virulence .

Identification of Protective Antigens

Systematic evaluation of Mycobacterium tuberculosis proteins has identified potential protective subunit vaccine candidates . Antigens like Rv1485 and Rv1705c have shown protective efficacy in mouse models, reducing lung CFU counts and inducing a Th1 immune response .

Whole-Genome Sequencing and Transmission Inference

Whole-genome sequencing can detect microevolution within Mycobacterium tuberculosis strains, aiding in the investigation of community outbreaks and allowing inference about the direction of transmission between cases . This technique has the potential to identify super-spreaders and predict undiagnosed cases, leading to early treatment and contact tracing .

Tables of Data

ProteinDescriptionFunction/Role
Rv1357c/MT1400Uncharacterized proteinCyclic di-GMP phosphodiesterase, affects pellicle production and virulence
Rv1738Protein upregulated in dormancy conditionsMay trigger dormancy by association with the bacterial ribosome
Rv1417Binds to Erp protein, potential drug target
Rv2617cBinds to Erp protein, potential drug target
Rv1485Protective antigen, induces Th1 immune response
Rv1705cPE/PPE proteinProtective antigen, induces Th1 immune response

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its use.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Target Names
Rv1357c, MT1400
Target Protein Sequence
MDRCCQRATAFACALRPTKLIDYEEMFRGAMQARAMVANPDQWADSDRDQVNTRHYLSTS MRVALDRGEFFLVYQPIIRLADNRIIGAEALLRWEHPTLGTLLPGRFIDRAENNGLMVPL TAFVLEQACRHVRSWRDHSTDPQPFVSVNVSASTICDPGFLVLVEGVLGETGLPAHALQL ELAEDARLSRDEKAVTRLQELSALGVGIAIDDFGIGFSSLAYLPRLPVDVVKLGGKFIEC LDGDIQARLANEQITRAMIDLGDKLGITVTAKLVETPSQAARLRAFGCKAAQGWHFAKAL PVDFFRE
Uniprot No.

Q&A

How should researchers optimize expression and purification of recombinant Rv1357c/MT1400?

For optimal expression, recombinant Rv1357c/MT1400 can be produced in E. coli expression systems with an N-terminal His tag to facilitate purification . The following methodological considerations are important:

  • Expression conditions: Optimize temperature (typically 16-25°C after induction), IPTG concentration (0.1-1.0 mM), and expression duration (4-24 hours).

  • Solubility enhancement: Consider using fusion partners (MBP, SUMO, etc.) if solubility is limited. This approach has been successful with other mycobacterial proteins as demonstrated with Rv0455c, where MBP fusion affected protein localization .

  • Purification protocol: Implement a two-step purification process:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography to achieve >90% purity

  • Buffer optimization: Store purified protein in Tris-based buffer with 50% glycerol at pH 8.0 to maintain stability . When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage recommendations: Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles, as this may compromise protein integrity .

What methodological approaches are most effective for investigating the function of uncharacterized proteins like Rv1357c/MT1400?

A multi-faceted approach is recommended for functional characterization:

  • Comparative genomics analysis: Identify homologs in related species and analyze conserved domains to infer potential functions. Look for conservation patterns across mycobacterial species.

  • Interactome analysis: Investigate protein-protein interactions using techniques like:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid systems

    Existing data suggests Rv1357c forms a fully connected interaction tetrad with RegX3, MprA, and Rv1354c proteins, indicating potential regulatory functions .

  • Gene knockout and complementation: Generate a deletion mutant (Δrv1357c) in M. tuberculosis, followed by phenotypic analysis. Complementation with wild-type or mutated versions can confirm gene-phenotype relationships. This approach has been successfully used for other mycobacterial proteins like Rv0455c .

  • Structural analysis: Crystallography or cryo-EM to determine three-dimensional structure. For example, the structure of the Rv0455c homolog MSMEG_3494 revealed a novel helical bundle with a cinch topology formed by a disulfide bond .

  • Transcriptional analysis: RT-qPCR or RNA-seq to identify conditions that affect rv1357c expression, similar to approaches used to analyze phoP-regulated genes like rv0805 .

How can researchers design experiments to determine if Rv1357c/MT1400 is involved in stress response mechanisms?

Design a systematic experimental approach:

  • Expression analysis under various stresses:

    • Expose M. tuberculosis cultures to different stresses (oxidative, acidic pH, hypoxia, nutrient limitation, host-mimicking conditions)

    • Measure rv1357c expression levels using RT-qPCR with gene-specific primers

    • Compare with known stress-response genes as controls

  • Stress sensitivity assays with mutant strains:

    • Generate Δrv1357c knockout and complement strains

    • Compare growth and survival under defined stress conditions

    • Include appropriate controls (wild-type, complemented strain)

  • Regulon identification:

    • Perform RNA-seq comparing wild-type and Δrv1357c strains under normal and stress conditions

    • Identify differentially expressed genes to map potential regulatory networks

    • Validate key findings with RT-qPCR

  • Protein modification analysis:

    • Examine post-translational modifications under stress conditions

    • Investigate protein stability and turnover rates

    • Analyze subcellular localization changes during stress

This experimental design draws on approaches used to characterize other M. tuberculosis proteins involved in stress response, as demonstrated with PhoP .

What is known about the protein interaction network involving Rv1357c/MT1400?

Computational analysis of protein interaction networks has identified Rv1357c as part of a significant interaction cluster in M. tuberculosis:

  • Key interaction partners: Rv1357c forms a fully connected tetrad of protein interactions with RegX3, MprA, and Rv1354c . This tightly connected interaction module suggests a potential functional relationship between these proteins.

  • Regulatory context: The interaction with RegX3 and MprA is particularly noteworthy as both are response regulators in two-component systems:

    • RegX3 is part of the SenX3-RegX3 two-component system involved in phosphate sensing and virulence

    • MprA belongs to the MprAB two-component system that regulates stress response genes

  • Network visualization: The interaction network can be visualized using Cytoscape, with centrality measures calculated to identify hub proteins within the network .

  • Gene expression correlation: Network analysis incorporating gene expression correlation values greater than 0.5 provides additional evidence for functional relationships among these proteins .

The close association with regulatory proteins suggests Rv1357c/MT1400 may function in signal transduction or adaptation to environmental conditions, which are critical processes for M. tuberculosis pathogenesis.

How can researchers experimentally validate predicted protein interactions of Rv1357c/MT1400?

To validate computational predictions of protein interactions, researchers should implement the following experimental approaches:

  • In vitro validation:

    • Pull-down assays: Use purified recombinant His-tagged Rv1357c/MT1400 as bait to capture interaction partners from M. tuberculosis lysates

    • Surface Plasmon Resonance (SPR): Determine binding affinities and kinetics between Rv1357c and purified interaction partners

    • Isothermal Titration Calorimetry (ITC): Measure thermodynamic parameters of protein-protein interactions

  • In vivo validation:

    • Bacterial two-hybrid system: Adapt for mycobacterial proteins to detect interactions in a cellular context

    • Co-immunoprecipitation: Use antibodies against native proteins or epitope tags

    • Proximity-based labeling: Employ BioID or APEX2 fusions to identify proteins in close proximity to Rv1357c in living bacteria

  • Mutational analysis:

    • Generate site-directed mutants of key residues in Rv1357c

    • Test effects on interaction with partner proteins

    • Correlate with functional assays to determine biological significance

  • Subcellular co-localization:

    • Fluorescent protein fusions or immunofluorescence microscopy

    • Similar to approaches used for studying Rv0455c localization

    • Fractionation studies to determine membrane association

These methods have been successfully applied to validate interactions of other M. tuberculosis proteins, providing a framework for Rv1357c/MT1400 interaction studies.

How is the expression of Rv1357c/MT1400 regulated in Mycobacterium tuberculosis?

While specific information about Rv1357c/MT1400 regulation is limited in the available search results, understanding regulatory mechanisms can be approached through:

  • Promoter analysis: Examine the upstream region of rv1357c for potential transcription factor binding sites. Methods similar to those used to identify PhoP binding sites in the rv0805 promoter region could be applied .

  • Transcription factor binding studies: Perform electrophoretic mobility shift assays (EMSA) with purified transcription factors and the rv1357c promoter region. For example, PhoP binding to the rv0805 promoter was demonstrated using phosphorylated PhoP and radio-labeled promoter DNA .

  • Expression profiling: Analyze rv1357c expression under various growth conditions and in different genetic backgrounds (e.g., transcription factor mutants). RT-qPCR with gene-specific primers can quantify expression changes, as demonstrated for rv0805 and rv0891c in wild-type and phoP mutant strains .

  • Reporter gene assays: Construct rv1357c promoter-reporter fusions to monitor expression in different conditions and genetic backgrounds.

Based on the interaction with regulatory proteins like RegX3 and MprA , rv1357c expression might be influenced by environmental signals sensed by these two-component systems, suggesting potential roles in stress response or adaptation.

What methodological considerations are important when analyzing gene expression data for Rv1357c/MT1400?

When analyzing expression data for rv1357c, researchers should address several methodological considerations:

  • Reference gene selection:

    • Choose stable reference genes for normalization (e.g., sigA, 16S rRNA)

    • Validate reference gene stability under experimental conditions

    • Consider using multiple reference genes for robust normalization

  • Growth phase considerations:

    • M. tuberculosis gene expression can vary dramatically between exponential and stationary phases

    • Document harvesting OD600 and growth conditions precisely

    • Compare expression only between bacteria at similar growth phases

  • RT-qPCR optimization:

    • Design primers with optimal properties (length 18-22 bp, GC content 40-60%, Tm ~60°C)

    • Validate primer efficiency (90-110%) using standard curves

    • Include no-RT controls to detect genomic DNA contamination

    • Use technical replicates (minimum triplicate) and biological replicates (minimum triplicate)

  • Data analysis approaches:

    • Apply appropriate statistical methods (e.g., 2^-ΔΔCt method with validation)

    • Report both statistical significance (p-values) and biological significance (fold-change)

    • Present data with appropriate error bars (standard deviation or standard error)

These considerations reflect best practices in gene expression analysis and have been applied in studies of other M. tuberculosis genes, including phoP-regulated genes .

What methods can be used to investigate the potential role of Rv1357c/MT1400 in M. tuberculosis pathogenesis?

To investigate the role of Rv1357c/MT1400 in pathogenesis, researchers should implement a comprehensive approach:

  • Infection models:

    • Macrophage infection assays: Compare intracellular survival of wild-type, Δrv1357c mutant, and complemented strains in human or murine macrophages

    • Animal infection models: Evaluate bacterial burden, histopathology, and survival in mice infected with different strains

    • Advanced infection models: Consider granuloma models or human lung tissue models for more physiologically relevant contexts

  • Virulence factor analysis:

    • Examine whether Rv1357c affects known virulence mechanisms (e.g., phagosome maturation arrest, cytokine responses)

    • Measure secretion of immunomodulatory factors

    • Assess sensitivity to host defense mechanisms (reactive oxygen/nitrogen species, antimicrobial peptides)

  • Conditional gene expression:

    • Generate conditional mutants using inducible systems to study essential genes

    • Analyze timing of requirement during infection cycle

    • Similar approaches have been used for studying other M. tuberculosis genes including rv0805

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify pathways affected by Rv1357c/MT1400

    • Contextualize within known pathogenesis networks

These methodologies have been successfully applied to characterize other M. tuberculosis proteins, such as Rv0455c, which was shown to be important for siderophore secretion and virulence in mice .

Based on interaction partners, what are the hypothetical functions of Rv1357c/MT1400?

Based on the interaction network data, several hypothetical functions can be proposed for Rv1357c/MT1400:

  • Regulatory role in stress response:
    The interaction with RegX3 and MprA, both response regulators in two-component systems involved in stress sensing , suggests Rv1357c may function as:

    • A modulator of regulatory protein activity

    • A scaffold protein facilitating regulatory complex formation

    • An effector protein that implements cellular responses to stress signals

  • Signal transduction involvement:
    The interaction tetrad with RegX3, MprA, and Rv1354c points to potential roles in:

    • Fine-tuning phosphorylation cascades

    • Integrating signals from multiple environmental inputs

    • Similar to how PhoP integrates stress responses in M. tuberculosis

  • Metabolic adaptation:
    Considering the importance of metabolic reprogramming during infection:

    • Possible involvement in nutrient acquisition pathways

    • Potential role in energy metabolism regulation

    • Similar to how Rv0455c influences siderophore-mediated iron acquisition

  • Structural or membrane-associated function:
    The protein sequence and characteristics suggest:

    • Potential membrane association or protein complex formation

    • Possible involvement in cell envelope processes

    • Similarity to other uncharacterized proteins that were later found to have structural roles

These hypotheses provide a framework for targeted experimental design to elucidate the actual function of Rv1357c/MT1400.

How can researchers design experiments to determine if Rv1357c/MT1400 plays a role in drug resistance mechanisms?

To investigate potential roles in drug resistance, researchers should implement a systematic experimental design:

  • Differential expression analysis:

    • Compare rv1357c expression levels between drug-susceptible and resistant clinical isolates

    • Analyze expression changes following exposure to various anti-TB drugs

    • Perform time-course experiments to capture dynamic responses

  • Mutant susceptibility testing:

    • Determine minimum inhibitory concentrations (MICs) for various drugs against:

      • Wild-type M. tuberculosis

      • Δrv1357c deletion mutant

      • Complemented strain

      • Overexpression strain

    • Include first-line drugs (isoniazid, rifampicin, ethambutol, pyrazinamide) and second-line agents

  • Drug efflux assays:

    • Measure accumulation/efflux of fluorescent dyes (e.g., ethidium bromide)

    • Use radiolabeled antibiotics to track cellular retention

    • Compare results between wild-type and mutant strains

  • Resistance development rates:

    • Perform fluctuation analysis to determine mutation rates

    • Compare frequencies of resistance emergence between strains

    • Sequence resistant mutants to identify compensatory mutations

  • Protein-drug interaction studies:

    • Test direct binding between purified Rv1357c protein and antibiotics

    • Perform structural studies to identify potential drug-binding pockets

    • Use thermal shift assays to detect stabilization upon drug binding

These approaches have been successfully applied to characterize other M. tuberculosis proteins involved in drug responses and should be adaptable for studying Rv1357c/MT1400.

What cutting-edge techniques could help resolve contradictory findings about uncharacterized proteins like Rv1357c/MT1400?

Advanced technologies can help resolve contradictory findings:

  • CRISPRi/CRISPRa systems for mycobacteria:

    • Enables precise transcriptional repression or activation

    • Allows titration of expression levels to determine dose-dependent effects

    • Creates hypomorphic phenotypes for essential genes

    • Facilitates genome-wide screens for genetic interactions

  • Single-cell analysis:

    • Reveals heterogeneity in bacterial populations that may explain contradictory results

    • Technologies include:

      • Single-cell RNA-seq for expression heterogeneity

      • Time-lapse microscopy with reporter systems

      • Flow cytometry with fluorescent reporters

  • Proximity-dependent protein labeling:

    • BioID or APEX2 fusion proteins to identify context-specific interaction partners

    • Maps protein neighborhoods within different cellular compartments

    • Identifies transient interactions missed by traditional methods

  • Native mass spectrometry:

    • Preserves non-covalent interactions

    • Determines stoichiometry of protein complexes

    • Detects conformational changes upon binding partners or ligands

  • Cryo-electron tomography:

    • Visualizes protein complexes in their native cellular context

    • Bridges structural biology and cellular imaging

    • Provides spatial context for protein function

  • Integration of multi-omics data:

    • Combines transcriptomics, proteomics, metabolomics, and structural data

    • Uses machine learning to identify patterns across diverse datasets

    • Generates testable hypotheses for protein function

These advanced techniques provide complementary data that can resolve contradictions arising from traditional single-method approaches to protein characterization.

How does Rv1357c/MT1400 compare with homologous proteins in other mycobacterial species?

A comprehensive comparative analysis reveals important insights about evolutionary conservation and potential functional significance:

  • Conservation across mycobacterial species:

    • Perform BLAST/HMMER searches to identify homologs

    • Construct multiple sequence alignments to identify conserved residues

    • Create phylogenetic trees to understand evolutionary relationships

    • Analyze synteny to determine if genomic context is conserved

  • Functional insights from non-pathogenic mycobacteria:

    • Compare with homologs in M. smegmatis or M. vaccae

    • Determine if gene essentiality is conserved across species

    • Examine expression patterns in different growth conditions

  • Cross-complementation studies:

    • Test if homologs from other species can complement Δrv1357c phenotypes

    • Similar to approaches used with Rv0455c and MSMEG_3494, where M. tuberculosis Rv0455c could complement the growth defect of an M. smegmatis MSMEG_3494 deletion mutant

  • Correlation with pathogenicity:

    • Compare conservation between pathogenic (M. tuberculosis complex, M. leprae) and non-pathogenic mycobacteria

    • Identify pathogen-specific features that might relate to virulence

Cross-species comparative analysis provides evolutionary context and functional insights that cannot be obtained from studying a protein in isolation.

How can researchers distinguish between direct and indirect effects when characterizing phenotypes of Rv1357c/MT1400 mutants?

Distinguishing direct from indirect effects requires methodological rigor:

  • Complementation controls:

    • Full complementation with wild-type gene

    • Site-directed mutants targeting specific domains/residues

    • Heterologous complementation with homologs from related species

    • These approaches have been demonstrated with other M. tuberculosis proteins including Rv0455c

  • Temporal analysis:

    • Use inducible expression systems to monitor immediate vs. delayed effects

    • Time-course experiments to establish cause-effect relationships

    • Pulse-chase approaches to track protein dynamics

  • Biochemical validation:

    • In vitro reconstitution of proposed molecular activities

    • Enzyme assays with purified components

    • Direct binding assays with proposed interaction partners

  • Genetic interaction mapping:

    • Construct double mutants to identify epistatic relationships

    • Suppressor screens to identify compensatory mutations

    • Synthetic lethal/sick screens to identify parallel pathways

  • Multi-omics integration:

    • Compare immediate transcriptional, proteomic, and metabolomic changes

    • Identify primary nodes of perturbation

    • Map secondary effects through network analysis

  • Targeted validation:

    • Generate precise point mutations rather than complete gene deletions

    • Target specific protein-protein interactions using interface mutations

    • Employ domain swapping to identify functional protein regions

These approaches collectively build a framework of evidence that can distinguish direct functional roles from downstream consequences of protein deletion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.