Recombinant Uncharacterized protein Rv1362c/MT1407 (Rv1362c, MT1407)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please specify it in your order for prioritized development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Target Names
Rv1362c, MT1407
Target Protein Sequence
MTDDVRDVNTETTDATEVAEIDSAAGEAGDSATEAFDTDSATESTAQKGQRHRDLWRMQV TLKPVPVILILLMLISGGATGWLYLEQYRPDQQTDSGAARAAVAAASDGTIALLSYSPDT LDQDFATARSHLAGDFLSYYDQFTQQIVAPAAKQKSLKTTAKVVRAAVSELHPDSAVVLV FVDQSTTSKDSPNPSMAASSVMVTLAKVDGNWLITKFTPV
Uniprot No.

Q&A

What is the basic genomic and proteomic profile of Rv1362c?

Rv1362c is a gene located at position 1533948-1534610 on the negative strand of the Mycobacterium tuberculosis H37Rv genome. It encodes a protein of 220 amino acids (some annotations list 221 aa) with a gene length of 663 base pairs . The protein is classified within the "Cell wall and cell processes" functional category and is considered a putative membrane protein . Proteomic studies have identified this protein in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS techniques . Sequence analysis reveals similarity to other M. tuberculosis hypothetical proteins, sharing 25.9% identity in a 216 amino acid overlap with MTCY02B10.27c, and showing similarities to Rv0177, Rv1973, and Rv1972 .

What is known about the expression pattern of Rv1362c during infection?

Mass spectrometry studies have identified Rv1362c in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days post-infection but not at 30 days, suggesting a potential role in persistent infection rather than early establishment . Additionally, the protein has been detected in whole cell lysates of M. tuberculosis H37Rv but was notably absent from culture filtrate or membrane protein fractions in some studies . This differential detection pattern indicates potential regulation of expression depending on environmental conditions or infection stage.

What are the recommended methods for recombinant expression of Rv1362c?

For recombinant expression of Rv1362c, a membrane protein, specialized expression systems are required. The recommended approach involves:

  • Gene synthesis or PCR amplification from M. tuberculosis H37Rv genomic DNA

  • Cloning into an expression vector containing a strong promoter (T7 or tac) and affinity tag (His6 or GST)

  • Expression in E. coli strains optimized for membrane proteins (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Growth at lower temperatures (16-25°C) following induction

  • Extraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS

For challenging membrane proteins like Rv1362c, cell-free expression systems may offer advantages over in vivo systems. When purifying, a two-step purification process combining affinity chromatography with size exclusion chromatography in the presence of appropriate detergents helps maintain protein stability and native conformation.

What structural prediction approaches are most effective for analyzing Rv1362c?

For structural prediction of membrane proteins like Rv1362c, a multi-layered approach is recommended:

  • Transmembrane domain prediction using:

    • TMHMM Server (for basic predictions)

    • DeepTMHMM (for improved accuracy)

    • TOPCONS (consensus prediction)

  • Intrinsically disordered region (IDR) analysis using:

    • ANCHOR2 for binding disordered regions (BDRs)

    • IUPred2A for general disorder prediction

  • Advanced structural modeling with:

    • AlphaFold2 or RoseTTAFold for de novo prediction

    • Molecular dynamics simulations in membrane environments

Similar approaches were successfully employed for related mycobacterial membrane proteins Rv1417 and Rv2617c, as described by Klepp et al., revealing important structural features including transmembrane helices and cytoplasmic terminal domains . These methods can identify potential functional domains and protein-protein interaction sites that might suggest functional roles for this uncharacterized protein.

How can researchers differentiate between Rv1362c and similar mycobacterial proteins in experimental systems?

Given that Rv1362c shares sequence similarity with several other mycobacterial proteins (including 25.9% identity with MTCY02B10.27c and similarities to Rv0177, Rv1973, and Rv1972) , researchers should implement the following differential identification strategies:

  • Design peptide-specific antibodies targeting unique regions of Rv1362c not conserved in homologous proteins (epitope mapping software can identify suitable regions)

  • Employ mass spectrometry-based targeted proteomics:

    • Multiple Reaction Monitoring (MRM) or Parallel Reaction Monitoring (PRM)

    • Focus on unique peptide sequences specific to Rv1362c

    • Use heavy isotope-labeled peptide standards as internal controls

  • Genetic approaches:

    • Construct gene-specific knockouts with complementation using tagged variants

    • Employ CRISPR interference targeting Rv1362c-specific sequences

    • Use gene-specific probes for qPCR or Northern blotting

These approaches ensure experimental specificity and prevent cross-reactivity or misidentification when studying closely related mycobacterial membrane proteins.

What experimental approaches can elucidate the function of Rv1362c in M. tuberculosis pathogenesis?

To determine the potential role of Rv1362c in pathogenesis, a comprehensive functional characterization strategy should include:

  • Genetic manipulation approaches:

    • CRISPR-Cas9 or homologous recombination-based gene deletion

    • Conditional knockdown systems (tetracycline-inducible)

    • Overexpression studies

    • Complementation with site-directed mutants

  • Infection models with wild-type and mutant strains:

    • Macrophage infection assays (survival, cytokine production)

    • Animal models (guinea pig, mouse) with time-course analysis

    • Competitive infection assays

  • Protein interaction studies:

    • Bacterial two-hybrid or split-GFP assays

    • Co-immunoprecipitation with potential partners

    • Crosslinking mass spectrometry

  • Stress response evaluation:

    • Growth under various stress conditions (hypoxia, nutrient limitation, acid stress)

    • Antibiotic susceptibility testing

    • Host immune factor resistance

Since Rv1362c was detected in guinea pig lungs at 90 days but not 30 days post-infection , special attention should be paid to its potential role in persistent infection stages and granuloma environments.

How can researchers investigate potential interactions between Rv1362c and other mycobacterial proteins?

To investigate protein-protein interactions involving Rv1362c, researchers should employ the following complementary approaches:

  • In silico prediction methods:

    • Homology-based interaction prediction

    • Coevolution analysis

    • Structural docking with predicted models

    • Analysis of genomic context and operons

  • Experimental validation techniques:

    • Split-protein complementation assays (bacterial two-hybrid, BACTH)

    • Pull-down assays with tagged recombinant Rv1362c

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST)

    • Crosslinking coupled with mass spectrometry (XL-MS)

  • Functional interaction assessment:

    • Genetic epistasis analysis with potential interactors

    • Co-localization studies using fluorescent protein fusions

    • Synthetic lethality screening

The identification of interaction partners would provide critical insights into the functional networks involving Rv1362c. Given its classification as a membrane protein involved in cell wall and cell processes , potential interaction partners might include other membrane proteins, cell wall synthesis enzymes, or transport systems.

What is the significance of Rv1362c being detected in infected guinea pig lungs at 90 days but not 30 days post-infection?

The temporal expression pattern of Rv1362c suggests several biologically significant possibilities:

  • Role in persistence mechanisms:

    • The protein may participate in metabolic adaptation for long-term survival

    • It could be involved in dormancy or stress response pathways activated during chronic infection

    • Potential function in restructuring the cell envelope for persistence

  • Immune evasion or modulation:

    • Expression might coincide with adaptive immune response onset

    • The protein could participate in granuloma maintenance or modification

    • Possible role in countering specific host defense mechanisms that emerge later in infection

  • Research implications:

    • Researchers should focus on late-stage infection models

    • Time-course experiments should extend beyond 90 days

    • Investigation of regulation should examine triggers present in chronic infection

This distinctive temporal expression pattern warrants investigation of Rv1362c as a potential persistence factor. Methodologically, researchers should employ inducible expression systems to study the protein's effect at different infection stages and consider dual RNA-seq approaches to correlate its expression with host response changes during infection progression.

How might structural similarities between Rv1362c and other membrane proteins inform drug development strategies?

The structural characterization of Rv1362c can inform targeted drug development through several approaches:

  • Comparative structural analysis:

    • Identify structural motifs shared with characterized membrane proteins

    • Determine if Rv1362c belongs to known membrane protein families

    • Map conserved functional domains that could serve as drug targets

  • Structural vulnerability assessment:

    • Identify potential small molecule binding pockets

    • Analyze membrane-embedded regions for accessibility

    • Evaluate protein dynamics through molecular dynamics simulations

  • Structure-guided drug design workflow:

    • Virtual screening against predicted structure

    • Fragment-based drug discovery targeting specific domains

    • Development of conformation-specific inhibitors

  • Cross-species comparison:

    • Analyze structural conservation across mycobacterial species

    • Identify M. tuberculosis-specific structural features

    • Target regions absent in commensal or environmental mycobacteria

Despite Rv1362c being non-essential for in vitro growth , its presence during chronic infection makes it a potential target for drugs aimed at treating persistent tuberculosis, especially when combined with conventional antibiotics in multi-target approaches.

What role might Rv1362c play in antibiotic resistance or tolerance mechanisms?

While direct evidence linking Rv1362c to antibiotic resistance is limited, several hypotheses warrant investigation:

  • Potential mechanisms of involvement:

    • Alteration of cell envelope permeability

    • Participation in stress response pathways activated by antibiotics

    • Contribution to biofilm formation or persistence states

    • Drug efflux system component or regulator

  • Experimental approaches to test involvement:

    • Antibiotic susceptibility testing of Rv1362c knockout/overexpression strains

    • Time-kill curves to assess tolerance rather than resistance

    • Transcriptional response to antibiotic exposure

    • Biofilm formation and antibiotic penetration studies

  • Clinical relevance investigation:

    • Expression analysis in drug-resistant clinical isolates

    • Polymorphism assessment in treatment failure cases

    • Correlation of expression with minimum inhibitory concentrations (MICs)

The time-dependent expression pattern observed in guinea pig models aligns with the development of physiological antibiotic tolerance during persistent infection, suggesting Rv1362c might participate in adaptation mechanisms that reduce antibiotic efficacy without conferring classical resistance.

How can contradictions in experimental data regarding Rv1362c be systematically analyzed and resolved?

Contradictions in research data regarding Rv1362c require structured analytical approaches for resolution:

  • Application of contradiction pattern analysis:

    • Implement the (α, β, θ) notation system as described by recent methodologies

    • α represents the number of interdependent items

    • β indicates contradictory dependencies defined by domain experts

    • θ represents the minimum number of Boolean rules needed to assess contradictions

  • Systematic contradiction resolution protocol:

    • Catalog experimental conditions across contradictory studies

    • Identify variables that differ between experimental systems

    • Design controlled experiments to test specific hypotheses

    • Develop a unified data model integrating apparent contradictions

  • Common sources of contradiction in Rv1362c research:

    • Strain variations (lab strains vs. clinical isolates)

    • Growth conditions and medium composition

    • Detection method sensitivity differences

    • Time points of analysis

For example, the contradiction between Rv1362c's detection in whole cell lysates but not membrane fractions in some studies might be resolved by examining extraction methods, detergent types, or growth conditions that affect protein localization or expression levels.

How can transcriptomic and proteomic data be integrated to better understand Rv1362c regulation?

Multi-omics data integration provides comprehensive insights into Rv1362c regulation:

  • Data collection and normalization approaches:

    • RNA-seq under various conditions (stress, infection models, time course)

    • Proteomic profiling with emphasis on membrane fractions

    • Ribosome profiling to assess translational efficiency

    • ChIP-seq for transcription factor binding

  • Integration methodologies:

    • Correlation network analysis between transcript and protein levels

    • Time-lagged correlation to account for delays between transcription and translation

    • Bayesian network modeling to infer causal relationships

    • Machine learning approaches to identify patterns across datasets

  • Specific analyses for Rv1362c:

    • Identification of co-regulated genes to define regulons

    • Correlation with known stress response pathways

    • Analysis of post-transcriptional regulation mechanisms

    • Identification of potential small RNA regulators

The detection of Rv1362c protein in specific infection stages suggests complex regulatory mechanisms that may not be apparent at the transcriptional level alone, necessitating integrated approaches to fully understand its expression dynamics.

What bioinformatic pipelines are recommended for analyzing potential post-translational modifications of Rv1362c?

For comprehensive post-translational modification (PTM) analysis of Rv1362c, the following specialized bioinformatic pipeline is recommended:

  • Prediction phase:

    • PTM site prediction using algorithms specific to mycobacterial proteins

    • Structure-based prediction incorporating membrane topology

    • Conservation analysis of potential modification sites across species

    • Integration with known mycobacterial PTM patterns

  • Experimental data analysis workflow:

    • Specialized mass spectrometry data processing for membrane proteins

    • PTM-specific enrichment techniques (phosphopeptide enrichment, etc.)

    • Site localization probability calculation

    • Quantitative analysis across conditions

  • Functional assessment:

    • Structural modeling of modified vs. unmodified forms

    • Molecular dynamics simulations to assess PTM impact

    • Network analysis to identify PTM-dependent interactions

    • Pathway enrichment of proteins with similar modification patterns

PTM analysis of membrane proteins presents unique challenges due to hydrophobicity and limited tryptic digestion sites. Specialized approaches such as alternative proteases, in-membrane digestion protocols, and enhanced extraction methods should be employed when analyzing Rv1362c to overcome these technical limitations.

How can researchers design experiments to determine if Rv1362c is involved in specific stress response pathways relevant to M. tuberculosis pathogenesis?

To investigate Rv1362c's potential role in stress response pathways, researchers should implement this comprehensive experimental approach:

  • Expression profiling under relevant stresses:

    • Hypoxia (Wayne model and defined oxygen tensions)

    • Nutrient limitation (carbon, nitrogen, phosphorus starvation)

    • Acidic pH (modeling phagosomal environment)

    • Nitrosative and oxidative stress

    • Host-relevant antimicrobial peptides exposure

  • Functional phenotyping of mutant strains:

    StrainConditionMeasurement Parameters
    WT vs. ΔRv1362cHypoxiaSurvival, ATP levels, NAD+/NADH ratio
    WT vs. ΔRv1362cAcidic pHGrowth rate, membrane integrity, pH homeostasis
    ΔRv1362c+complementNutrient limitationMetabolomic profile, transcriptional response
    Rv1362c overexpressionOxidative stressROS levels, DNA/lipid damage markers
    Conditional knockdownMacrophage infectionBacterial survival, phagosome maturation
  • Pathway mapping strategies:

    • Epistasis analysis with known stress response regulators (DosR, PhoP, etc.)

    • ChIP-seq to identify potential regulators binding to the Rv1362c promoter

    • Phosphoproteomics before and after stress induction

    • Metabolic flux analysis in wild-type vs. mutant strains

  • Single-cell approaches:

    • Reporter constructs to monitor Rv1362c expression at single-cell level

    • Correlation with stress response heterogeneity

    • Fate tracking during stress exposure and recovery

These approaches would systematically evaluate Rv1362c's involvement in specific stress response pathways, contextualizing its function within the complex adaptation mechanisms that enable M. tuberculosis pathogenesis and persistence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.