Recombinant Uncharacterized protein Rv1417/MT1460 (Rv1417, MT1460)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Protein Rv1417/MT1460

The recombinant uncharacterized protein Rv1417/MT1460, commonly referred to as Rv1417, is a putative membrane protein associated with Mycobacterium tuberculosis (Mtb). Despite its uncharacterized nature, Rv1417 has been identified as a potential target for therapeutic interventions against tuberculosis due to its interactions with other proteins involved in Mtb virulence.

Role in Mycobacterium tuberculosis

Rv1417 interacts with the exported repetitive protein (Erp) and another membrane protein, Rv2617c. These interactions are crucial for the survival and replication strategies of Mtb, particularly in resisting oxidative stress from macrophages . The disruption of these interactions can potentially decrease Mtb replication and virulence .

Potential Therapeutic Targets

The interaction between Rv1417, Rv2617c, and Erp proteins presents opportunities for developing new anti-tuberculosis drugs. Recent studies have explored the use of nicotine analog molecules (NAMs) to inhibit the formation of heterodimers between these proteins. Four of these analogs have shown promise as potential candidates to counteract Mtb pathogenicity .

Table 1: Key Features of Rv1417 and Related Proteins

ProteinFunction/RoleInteraction PartnersPotential Therapeutic Targets
Rv1417Putative membrane protein, involved in Mtb survival and replicationErp, Rv2617cNicotine analogs
Rv2617cMembrane protein, essential for Mtb replication in mouse modelsErp, Rv1417Nicotine analogs
ErpExported repetitive protein, involved in Mtb virulenceRv1417, Rv2617cDisruption of interactions with Rv1417 and Rv2617c

Table 2: In Silico Techniques Used for Rv1417 Studies

TechniquePurposeOutcome
Molecular Dynamics (MD) SimulationsExplore conformational dynamics and protein interactionsIdentification of stable structures and interaction sites
Molecular DockingAnalyze binding affinities and interactions with potential inhibitorsIdentification of nicotine analogs as potential inhibitors
Electrostatic Potential (ESP) SurfacesUnderstand electrostatic influences on protein interactionsInsights into binding energies and interaction mechanisms

References Study of the Rv1417 and Rv2617c Membrane Proteins and Their Interactions with Erp Protein. PMC9953637. Compositions and Methods for Inhibiting Bacterial Growth. FreePatentsOnline. Novel In Silico Insights into Rv1417 and Rv2617c as Potential Protein Targets. PMC9269478. Novel In Silico Insights into Rv1417 and Rv2617c as Potential Protein Targets. MDPI Polymers. Study of the Rv1417 and Rv2617c Membrane Proteins and Their Interactions with Erp Protein. PubMed.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Target Names
Rv1417, MT1460
Target Protein Sequence
MTAAPNDWDVVLRPHWTPLFAYAAAFLIAVAHVAGGLLLKVGSSGVVFQTADQVAMGALG LVLAGAVLLFARPRLRVGSAGLSVRNLLGDRIVGWSEVIGVSFPGGSRWARIDLADDEYI PVMAIQAVDKDRAVAAMDTVRSLLARYRPDLCAR
Uniprot No.

Q&A

What is the basic structure and function of Rv1417 protein?

Rv1417 is a 154 amino acid conserved membrane protein encoded by the Mycobacterium tuberculosis H37Rv genome. The protein sequence begins with VTAAPNDWDVVLRPHWTPLFAY and continues with predominantly hydrophobic residues forming transmembrane helices . Structural analyses using computational methods have shown that Rv1417 contains transmembrane alpha-helical domains that anchor it within the mycobacterial cell membrane .
The protein belongs to the functional category of "Cell wall and cell processes" according to mycobacterial genome annotation systems . While its precise function remains uncharacterized, proteomic studies have consistently identified it in the membrane fraction using techniques such as 1D-SDS-PAGE and uLC-MS/MS, confirming its classification as a membrane-associated protein . The protein shows approximately 32.4% sequence identity with homologs in other bacterial species, including Streptomyces coelicolor .

How is Rv1417 genetically organized in the M. tuberculosis genome?

Rv1417 is located at genomic coordinates 1592150-1592614 on the positive strand of the M. tuberculosis H37Rv genome . An important aspect of its genetic organization is that Rv1417 forms an operon with the upstream gene Rv1416, as demonstrated by RT-PCR experiments (Klepp et al., 2009) . This co-transcription suggests a functional relationship between these two genes, potentially indicating that they participate in related cellular processes. Gene organization in operons often reflects protein functional coupling, which could provide clues to Rv1417's biological role despite its current "uncharacterized" status.

What is known about Rv1417's interaction with the Erp virulence factor?

Rv1417 has been identified as one of the proteins that interact with the Exported Repetitive Protein (Erp) virulence factor from Mycobacterium tuberculosis . This interaction was initially discovered using bacterial two-hybrid system experiments (Klepp et al., 2009) . Subsequent computational studies have provided detailed insights into the structural basis of this interaction.
Molecular dynamics (MD) simulations and molecular docking analyses have shown that Rv1417-Erp heterodimers form energetically favorable complexes, particularly under membrane conditions . The interaction interfaces involve multiple contact points between the two proteins, with the Erp protein often serving as the main guideline for these protein interactions . When visualized through computational modeling, these heterodimers reveal specific contact residues on the protein interface, with Erp residues depicted in green and Rv1417 residues in red-orange colors in structural analyses .
The stability of these protein complexes is influenced by the surrounding medium, with membrane-associated complexes showing greater energetic favorability than those formed in semipolar environments . This suggests that the natural membrane environment plays a crucial role in facilitating functional interactions between these proteins.

How does the membrane environment affect Rv1417's structure and interactions?

The membrane environment significantly influences both the structural conformation of Rv1417 and its ability to form stable interactions with partner proteins like Erp. Computational studies using MD simulations have revealed several key aspects of this relationship:

  • Structural Stability: When embedded in a dipalmitoylphosphatidylcholine (DPPC) bilayer, Rv1417 adopts a more stable conformation compared to semipolar environments . The protein-membrane system demonstrates characteristic transmembrane alpha-helical domains that traverse the lipid bilayer.

  • Movement Within Membranes: Analysis of protein movement through the lipid bilayer shows specific patterns of lateral diffusion, as measured by mean square displacement (MSD) calculations of both the protein and lipid head groups .

  • Protein-Protein Interactions: The membrane environment provides a two-dimensional constraint that facilitates protein-protein interactions. Studies of Rv1417-Erp complexes have demonstrated that membrane-associated heterodimers form more energetically favorable complexes than those in semipolar environments .

  • Solvent Accessible Surface Area: The membrane environment alters the solvent accessible surface area (SASA) of the protein, affecting which regions can participate in protein-protein interactions .
    These findings highlight the importance of considering the native membrane environment when studying Rv1417's structure and function, particularly for drug discovery efforts targeting this protein or its interactions.

What are the best methods for recombinant expression and purification of Rv1417?

Given Rv1417's nature as a membrane protein, special considerations are necessary for successful recombinant expression and purification:
Expression Systems:

  • E. coli-based systems: For initial expression studies, E. coli BL21(DE3) with specialized vectors containing fusion tags (His6, MBP, or SUMO) can be used to enhance solubility and facilitate purification.

  • Mycobacterial expression systems: For obtaining more native-like protein, M. smegmatis mc²155 expression systems may provide better folding of mycobacterial membrane proteins.
    Induction and Culture Conditions:

  • Temperature: Lower induction temperatures (16-20°C) often improve membrane protein folding

  • Inducers: Use of IPTG at concentrations of 0.1-0.5 mM for controlled expression

  • Additives: Inclusion of glycerol (5-10%) and specific detergents in growth media
    Purification Protocol:

  • Cell lysis using methods gentle for membrane proteins (French press or sonication with protease inhibitors)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (CHAPS, DDM, or Triton X-114 as used in proteomic studies )

  • Affinity chromatography using immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography for final purification and buffer exchange
    Quality Control Metrics:

  • SDS-PAGE with Coomassie staining for purity assessment

  • Western blotting with anti-His or specific antibodies

  • Circular dichroism to confirm secondary structure integrity

  • Dynamic light scattering for homogeneity evaluation
    These approaches are based on successful membrane protein purification strategies and the specific detection of Rv1417 in Triton X-114 extracts of M. tuberculosis H37Rv as documented in previous studies .

What computational methods are most effective for studying Rv1417 structure?

Several computational methods have proven valuable for investigating Rv1417's structure and interactions:
Structure Prediction:

  • AlphaFold: The AlphaFold database provides three-dimensional structures for Rv1417 (AF-P9WLY1-F1), which serve as valuable starting points for computational analyses .

  • Deep learning protein language models: These have been used to predict transmembrane helices and disordered protein regions in Rv1417 .
    Molecular Dynamics Simulations:

  • Membrane embedding: The InflateGRO methodology has been successfully applied to embed Rv1417 into DPPC bilayers for simulation studies .

  • Simulation parameters: Effective MD simulations have been conducted at 309.15 K and 1 bar conditions .

  • Analysis methods: Stability descriptors, hydrogen bond analysis, density profiles along the z-axis, solvent accessible surface area (SASA) calculations, and mean square displacement (MSD) measurements have provided valuable insights into Rv1417's behavior .
    Protein-Protein Interaction Studies:

  • Molecular docking calculations: Using tools like FireDock to identify energetically favorable molecular complexes between Rv1417 and partner proteins .

  • Interface analysis: Identification of contact residues at protein interfaces and generation of heat maps showing the frequency of residue contacts .
    Other Useful Methods:

  • IUPred2 and ANCHOR2 algorithms: These have been used to analyze disorder regions in Rv1417 .

  • Electrostatic potential surface mapping: This technique helps visualize charge distribution on protein surfaces, which influences interaction potential.
    The integration of these computational approaches provides a comprehensive understanding of Rv1417's structural properties and interaction capabilities.

What evidence exists for Rv1417's role in M. tuberculosis pathogenesis?

While Rv1417 is classified as an uncharacterized protein, several lines of evidence suggest its potential involvement in M. tuberculosis pathogenesis:

  • Interaction with Virulence Factors: Rv1417 interacts with the Erp (Exported Repetitive Protein) virulence factor, which is known to be important for M. tuberculosis virulence . Experimental studies have demonstrated that these interactions are stable and specific, suggesting functional relevance.

  • Partner Protein Functions: The Erp protein has been shown to play an essential role in the mechanism of resistance to the microbicidal action of macrophages, particularly against oxidative stress . Rv1417's interaction with Erp suggests it may participate in these protective mechanisms.

  • Membrane Localization: Rv1417 has been consistently identified in the membrane fraction of M. tuberculosis , positioning it at the interface between the bacterium and its environment, where many virulence-associated processes occur.

  • Conservation: The protein shows conservation across mycobacterial species and has homologs in other bacteria like Streptomyces coelicolor , suggesting an important biological function that has been preserved through evolution.

  • Gene Organization: Rv1417 forms an operon with Rv1416 , suggesting coordinated expression and potentially related functions that may contribute to bacterial survival or virulence.
    While direct virulence studies specific to Rv1417 knockout strains are not extensively documented in the provided search results, these associations strongly suggest that the protein may contribute to M. tuberculosis survival within the host environment.

How does Rv1417 compare structurally and functionally to similar proteins in other bacteria?

Rv1417 shares structural and sequence similarities with proteins from other bacterial species, providing context for understanding its potential functions:
Sequence Homology:
Rv1417 shows approximately 32.4% sequence identity in a 136 amino acid overlap with a protein from Streptomyces coelicolor (encoded by gene SC6D7_2, AL133213) . This level of sequence conservation suggests potential functional similarity, though the specific functions of the S. coelicolor homolog are also not fully characterized.
Structural Comparison:
Computational analyses of Rv1417's structure show characteristic features of bacterial membrane proteins:

  • Conservation among proteins involved in cell envelope processes

  • Potential roles in protein-protein interaction networks that contribute to bacterial adaptation

  • Non-essentiality under standard growth conditions but potential importance under specific environmental challenges
    This comparative analysis suggests that Rv1417 belongs to a class of bacterial membrane proteins that may serve as adaptors or scaffolds in protein complexes involved in cell envelope functions or stress responses.

How can researchers design inhibitors targeting Rv1417-Erp protein interactions?

Designing inhibitors targeting the Rv1417-Erp interaction requires a systematic approach based on structural and functional understanding:
Target Interface Identification:
Computational studies have mapped the interaction interfaces between Rv1417 and Erp proteins . Heat maps of the main contacts between these proteins highlight the residues most frequently involved in the interaction . These contact points represent primary targets for inhibitor design.
Inhibitor Design Strategies:

  • Structure-Based Design:

    • Using the three-dimensional structures of Rv1417-Erp complexes from molecular docking and MD simulations to design molecules that can disrupt key interactions

    • Focusing on peptidomimetic compounds that mimic the interface regions but block functional interaction

    • Employing computational screening of virtual compound libraries against the interface binding sites

  • Fragment-Based Approaches:

    • Identifying small molecular fragments that bind to hotspots on either protein

    • Building these fragments into larger, more specific inhibitors

    • Utilizing biophysical techniques like surface plasmon resonance (SPR) to validate fragment binding

  • Natural Product Derivatives:

    • Research has already explored nicotine derivatives as potential inhibitors of Rv1417-Erp interactions

    • This approach can be expanded to other natural scaffolds with structural complementarity to the interaction interface

  • Rational Design Based on Interaction Environment:

    • Considering the membrane environment's influence on protein interactions

    • Designing compounds with appropriate hydrophobicity/hydrophilicity profiles for accessing membrane-embedded interaction sites
      Validation Methodologies:

  • In silico validation using molecular docking and MD simulations to predict binding affinity and stability

  • Biochemical assays such as pull-down assays to measure disruption of protein-protein interactions

  • Cellular assays to assess effects on mycobacterial survival under relevant stress conditions
    This multi-faceted approach provides a framework for developing inhibitors that could potentially disrupt Rv1417-Erp interactions and thereby impact M. tuberculosis virulence mechanisms.

What are the key technical challenges in crystallizing Rv1417 for structural studies?

Obtaining crystal structures of membrane proteins like Rv1417 presents several significant technical challenges:
Inherent Membrane Protein Crystallization Challenges:

ChallengeTechnical DetailsPotential Solutions
Protein stabilityMembrane proteins often destabilize when removed from their native lipid environmentUse of stabilizing detergents (DDM, LMNG); addition of lipids; fusion with crystallization chaperones
Conformational heterogeneityMultiple conformational states reduce crystallization probabilityLigand or antibody binding to stabilize specific conformations; engineering to reduce flexible regions
Hydrophobic surfacesLarge hydrophobic regions create unfavorable crystal contactsCreation of fusion constructs with soluble proteins; use of antibody fragments to create crystal contacts
Detergent micelle interferenceDetergent micelles surrounding the protein can prevent crystal contact formationScreening various detergents; use of facial amphiphiles; lipidic cubic phase crystallization
Low expression yieldsMembrane proteins typically express at lower levelsOptimization of expression systems; use of specialized vectors and host strains; scale-up of production
Rv1417-Specific Considerations:
  • Predicted Disordered Regions:
    Computational analyses have identified disordered regions in Rv1417 , which typically impede crystallization. Constructs may need to be designed that remove or stabilize these regions.

  • Transmembrane Domains:
    The transmembrane helices predicted in Rv1417 require special consideration during purification and crystallization to maintain their native structure.

  • Protein-Partner Interactions:
    The interaction with Erp protein might be exploited by attempting co-crystallization, which sometimes stabilizes conformations favorable for crystal formation.

  • Alternative Structural Approaches:
    When crystallization proves exceptionally challenging, researchers may consider:

    • Cryo-electron microscopy (cryo-EM) for structural determination

    • NMR studies of specific domains or fragments

    • Continued refinement of computational models based on biochemical constraints
      Understanding these challenges allows researchers to develop strategic approaches to Rv1417 structure determination, potentially combining multiple techniques to build a complete structural picture.

How should researchers interpret contradictory findings about Rv1417 function across different experimental systems?

When faced with contradictory findings regarding Rv1417 function, researchers should employ a systematic analysis framework:
Sources of Experimental Variation:

  • Different experimental systems: Results may vary between in vitro biochemical assays, cellular systems (E. coli vs. mycobacterial expression), and in vivo models.

  • Environmental conditions: Studies conducted under different pH, ionic strength, or membrane composition conditions may yield different results for membrane proteins like Rv1417.

  • Protein preparation methods: Variations in purification tags, detergents used, and protein handling can affect protein conformation and activity.

  • Partner protein presence: Rv1417's function may depend on interaction partners like Erp , and their absence or presence can alter results.
    Reconciliation Strategies:

  • Contextual interpretation: Evaluate each finding in the context of the specific experimental setup used. For example, computational predictions of Rv1417-Erp interactions in membrane environments show different energetics than in semipolar conditions .

  • Multiple complementary techniques: Validate key findings using orthogonal methods. For instance, in silico predictions of protein interactions should be validated with biochemical methods like pull-down assays.

  • Physiological relevance assessment: Prioritize findings from conditions that more closely mimic the native environment. Rv1417 is a membrane protein , so studies conducted in membrane or membrane-mimetic environments may better reflect its natural behavior.

  • Integration with broader knowledge: Interpret contradictory findings within the context of known mycobacterial biology and pathogenesis mechanisms. Rv1417's interaction with virulence factors suggests potential roles in pathogenesis despite being non-essential for in vitro growth .

  • Hypothesis generation: Use contradictions to formulate testable hypotheses that might explain the differences, such as condition-specific functions or conformational changes.
    By applying these strategies, researchers can develop a more nuanced understanding of Rv1417's function and reconcile apparently contradictory findings into a coherent biological model.

What statistical approaches are most appropriate for analyzing Rv1417-protein interaction data?

  • Binding Energy Analysis:

    • Scoring functions used in molecular docking (as seen in the FireDock calculations for Rv1417-Erp interactions )

    • Statistical significance assessment through comparison with randomized docking controls

    • Multiple replica analysis to establish confidence intervals for binding energies

  • Molecular Dynamics Trajectory Analysis:

    • RMSD (Root Mean Square Deviation) stability assessment over time

    • Principal Component Analysis (PCA) to identify major conformational motions

    • Cluster analysis to identify predominant structural states

    • Statistical tests to compare protein behavior in different environments (membrane vs. solution)

  • Contact Residue Analysis:

    • Frequency-based assessment of residue contacts across simulation time points

    • Heat maps showing contact statistics between protein partners

    • Statistical tests to determine significance of specific interaction hotspots
      For Experimental Interaction Data:

  • Protein-Protein Interaction Assays:

    • Appropriate controls for non-specific binding in pull-down or co-immunoprecipitation experiments

    • Statistical tests comparing binding under different conditions (t-tests, ANOVA)

    • Dose-response curves and affinity calculations for quantitative binding studies

  • Inhibitor Screening Data:

    • Z-factor analysis to assess assay quality and robustness

    • Dose-response curve fitting with appropriate models (4-parameter logistic)

    • Multiple testing correction for high-throughput screening (Benjamini-Hochberg procedure)

  • Structural Biology Data:

    • R-factor and R-free statistics for crystallographic data quality

    • Resolution-dependent statistical validation of structural features

    • Model validation statistics (Ramachandran plots, MolProbity scores)
      Data Integration Approaches:

What are the most promising research directions for elucidating Rv1417's role in tuberculosis pathogenesis?

Based on current knowledge about Rv1417, several promising research directions could significantly advance understanding of its role in tuberculosis pathogenesis:

  • Conditional Gene Knockout Studies:
    While Rv1417 is non-essential under standard laboratory conditions , creating conditional knockouts to test its importance under various stress conditions (oxidative stress, low pH, nutrient limitation) would help determine if it becomes essential during infection-relevant conditions.

  • In vivo Infection Models:
    Comparing wild-type M. tuberculosis with Rv1417 mutants in animal infection models would help assess its contribution to virulence, bacterial burden, and granuloma formation. Particular attention should be paid to early infection stages and macrophage interactions.

  • Comprehensive Interactome Mapping:
    Expanding beyond the known Erp interaction to identify the complete set of Rv1417 protein partners using techniques such as proximity labeling (BioID) or cross-linking mass spectrometry would provide a broader context for its cellular functions.

  • Structure-Function Relationship Studies:
    Combining structural predictions with site-directed mutagenesis of key residues involved in protein-protein interactions would help delineate the specific molecular mechanisms by which Rv1417 contributes to cellular processes.

  • Transcriptional Regulation Analysis:
    Since Rv1417 forms an operon with Rv1416 , investigating how this operon is regulated under different conditions could provide insights into when and why Rv1417 is expressed during infection.

  • Host Response Studies:
    Examining how Rv1417 or its complexes interact with host factors, particularly those involved in innate immunity, could reveal mechanisms by which this protein might contribute to immune evasion.

  • Drug Discovery Targeting Rv1417-Erp Interaction:
    Building on initial studies of nicotine derivatives , development of small molecule inhibitors specifically disrupting Rv1417's interaction with virulence factors could provide both therapeutic leads and research tools to probe function.
    These research directions, pursued in combination, would provide a comprehensive understanding of Rv1417's role in tuberculosis pathogenesis and potentially identify new intervention strategies.

What technological advancements would most benefit Rv1417 research?

Several cutting-edge technological advancements could significantly accelerate research on Rv1417 and similar mycobacterial membrane proteins:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy (cryo-EM) advancements for membrane protein complexes would enable visualization of Rv1417 in its native membrane environment and in complex with partners like Erp

    • Integrative structural biology approaches combining multiple data types (crosslinking MS, SAXS, cryo-EM) to build comprehensive structural models

    • Time-resolved structural methods to capture dynamic conformational changes during protein interactions

  • Membrane Protein-Specific Technologies:

    • Nanodiscs and native nanodiscs for studying membrane proteins in more native-like lipid environments

    • Cell-free expression systems optimized for mycobacterial membrane proteins

    • Lipidic cubic phase crystallization advancements for membrane protein structure determination

  • Improved Computational Methods:

    • Enhanced MD simulation capabilities for longer timescale simulations of membrane protein dynamics

    • AI-powered protein function prediction algorithms specific for mycobacterial proteins

    • Quantum mechanical/molecular mechanical (QM/MM) approaches for detailed analysis of specific interaction regions

  • Advanced Cellular Imaging:

    • Super-resolution microscopy techniques to visualize Rv1417 localization and dynamics in living mycobacteria

    • Single-molecule tracking to follow individual protein molecules within bacterial membranes

    • Correlative light and electron microscopy (CLEM) to connect protein function to ultrastructural features

  • Genetic Engineering Advancements:

    • CRISPR-Cas systems optimized for mycobacteria for precise genetic manipulation

    • Inducible degradation systems for temporal control of Rv1417 levels

    • Site-specific in vivo crosslinking technologies to capture transient interactions

  • High-Throughput Screening Platforms:

    • Microfluidic systems for testing Rv1417 function under diverse environmental conditions

    • Fragment-based screening approaches specific for membrane protein targets

    • Biosensor development for real-time monitoring of protein-protein interactions These technological advancements would address many of the current challenges in studying membrane proteins like Rv1417 and could lead to breakthrough discoveries about its structure, function, and potential as a drug target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.