Recombinant Uncharacterized protein Rv1591/MT1626 (Rv1591, MT1626)

Shipped with Ice Packs
In Stock

Description

Introduction to Rv1591/MT1626

Rv1591/MT1626 is a protein encoded by the Rv1591 gene in Mycobacterium tuberculosis, identified in both the H37Rv and CDC1551 strains. Though its precise function remains unknown, it has been categorized as a "probable transmembrane protein" within the functional category of "Cell wall and cell processes" . This protein represents one of the numerous mycobacterial components that may contribute to the unique physiology and pathogenicity of M. tuberculosis. Despite being classified as uncharacterized, its conservation across mycobacterial species suggests potential biological significance . The protein has been the subject of recombinant expression studies, mutational analyses, and is commercially available for research applications.

Genetic Context and Conservation

The Rv1591 gene is located on the positive strand of the M. tuberculosis H37Rv genome at coordinates 1791570-1792235 . The gene is considered a "core mycobacterial gene" as it shows conservation across various mycobacterial strains, as noted in studies by Marmiesse et al., 2004 . This conservation across species suggests that the protein may serve a fundamental role in mycobacterial physiology.

The protein shows sequence similarity to other mycobacterial proteins, particularly a hypothetical protein from Mycobacterium leprae (the causative agent of leprosy), with approximately 63.8% identity over a 188 amino acid overlap . This homology across pathogenic mycobacterial species further supports the potential biological significance of Rv1591.

Genetic Regulation

According to the MTB Network Portal, Rv1591 is predicted to be co-regulated in specific modules:

ModuleResidual Value
bicluster_00650.72
bicluster_04910.60

This regulation may be mediated by cis-regulatory motifs with varying e-values, suggesting complex transcriptional control mechanisms that could provide insights into the protein's biological context and function .

Expression and Localization

Proteomics studies have identified Rv1591/MT1626 in the membrane fraction of M. tuberculosis H37Rv using various techniques including 1D-SDS-PAGE and uLC-MS/MS . The protein was not detected in the culture filtrate, consistent with its predicted role as an integral membrane protein . These findings align with bioinformatic predictions of Rv1591 as a transmembrane protein.

Translational start site analysis supported by proteomics data (Kelkar et al., 2011) has confirmed the annotated start codon, providing confidence in the predicted full-length protein sequence . The protein's membrane localization suggests potential roles in cell wall integrity, transport functions, or cell-environment interactions, though specific functions remain to be determined experimentally.

Functional Analysis and Mutant Studies

Despite being uncharacterized, insights into Rv1591's biological significance have been gained through mutational studies. Multiple independent research groups have created and analyzed transposon mutants disrupting the Rv1591 gene, with consistent findings regarding its essentiality:

StudyMethodFinding
Minato et al. 2019Himar1 transposon mutagenesis in H37Rv in MtbYM rich mediumNon-essential
DeJesus et al. 2017Analysis of saturated Himar1 transposon librariesNon-essential
Sassetti et al. 2003Himar1 transposon mutagenesis in H37RvNon-essential
Griffin et al. 2011Himar1 transposon mutagenesis in H37RvNon-essential

The consistent classification of Rv1591 as non-essential for in vitro growth indicates that while the protein may have important functions, it is not required for basic survival under standard laboratory conditions. This has important implications for understanding its biological role and potential as a drug target.

A specific transposon mutant, Transposon Mutant 1521, was created by disrupting Rv1591 (MT1626) in the CDC1551 strain as part of the Tuberculosis Animal Research and Gene Evaluation Taskforce (TARGET) initiative . This mutant is available for research through the BEI Resources collection (catalog number NR-15454), facilitating further studies into the protein's function .

Significance in Tuberculosis Research

Although uncharacterized, Rv1591/MT1626 holds significance in tuberculosis research for several reasons:

  1. As a membrane protein in M. tuberculosis, it may play roles in bacterial survival, virulence, or antibiotic resistance mechanisms. The cell envelope of mycobacteria is known to contribute significantly to pathogenicity and drug resistance.

  2. The availability of transposon mutants allows for comparative studies examining phenotypic changes when the protein is disrupted, potentially revealing hidden functions not obvious from sequence analysis alone.

  3. The protein's conservation across mycobacterial species suggests evolutionary preservation of function, highlighting its potential biological importance despite being non-essential for in vitro growth.

  4. As part of the cell wall and cell processes functional category, Rv1591 belongs to a group of proteins that are often targeted for anti-tuberculosis drug development due to their accessibility and critical functions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Target Names
Rv1591, MT1626
Target Protein Sequence
MLGLSATGVLVGGLWAWIAPPIHAVVAITRAGERVHEYLGSESQNFFIAPFMLLGLLSVL AVVASALMWQWREHRGPQMVAGLSIGLTTAAAIAAGVGALVVRLRYGALDFDTVPLSRGD HALTYVTQAPPVFFARRPLQIALTLMWPAGIASLVYALLAAGTARDDLGGYPAVDPSSNA RTEALETPQAPVS
Uniprot No.

Q&A

What are the predicted structural characteristics of Rv1591/MT1626?

The structural characterization of uncharacterized proteins like Rv1591/MT1626 begins with computational predictions followed by experimental validation. Based on approaches used with similar proteins:

  • Initial sequence analysis should identify conserved domains, motifs, and potential structural features

  • Secondary structure predictions (using tools like PSIPRED, JPred, and I-TASSER) can suggest the presence of α-helices and β-sheets

  • Tertiary structure modeling may be attempted using homology modeling if suitable templates exist

Methodological approach: Researchers should be aware that computational predictions may not match experimental findings. For example, Rv1211, another M. tuberculosis protein, was initially predicted to be a calmodulin-like calcium-binding protein with an EF-hand motif but was experimentally determined to be a natively unfolded protein . To properly characterize Rv1591/MT1626, employ multiple complementary techniques:

  • Circular dichroism (CD) experiments with temperature elevation

  • Trifluoroethanol treatment to assess propensity for induced folding

  • NMR experiments to confirm structural state and ligand binding capabilities

How conserved is Rv1591/MT1626 across mycobacterial species?

Conservation analysis provides important evolutionary context and functional hints:

  • Sequence conservation patterns can suggest functional importance

  • Highly conserved regions often indicate catalytic sites or binding interfaces

  • Evolutionary analysis can categorize the protein as core (essential) or accessory

Methodological approach: Perform multiple sequence alignment across mycobacterial species using tools like Clustal Omega. Calculate conservation scores for individual residues. Similar to how Rv1211 was identified as "a conserved hypothetical protein in Mycobacterium tuberculosis required for growth and pathogenesis" , determine if Rv1591/MT1626 demonstrates conservation patterns suggesting essential functions.

What expression systems are most effective for producing recombinant Rv1591/MT1626?

Selecting appropriate expression systems significantly impacts protein yield and quality:

  • E. coli systems (BL21, Rosetta) are commonly used for initial attempts

  • Mycobacterial expression systems may provide native post-translational modifications

  • Fusion tags (His, GST, MBP) can improve solubility and facilitate purification

Methodological approach: Systematic comparison of expression conditions using design of experiments (DOE) approach . Create a matrix of experimental conditions testing:

Expression SystemTemperatureInduction ConditionsFusion TagYield (mg/L)Solubility (%)
E. coli BL21(DE3)16°C0.1 mM IPTG, 18hN-HisTo be determinedTo be determined
E. coli BL21(DE3)25°C0.5 mM IPTG, 6hGSTTo be determinedTo be determined
E. coli Rosetta16°C0.1 mM IPTG, 18hMBPTo be determinedTo be determined
M. smegmatis37°CAcetamide, 24hN-HisTo be determinedTo be determined

Analyze results using statistical methods to identify optimal conditions.

How should experimental design be approached for characterizing Rv1591/MT1626?

Proper experimental design is critical for obtaining reliable, reproducible results:

  • Clearly define research questions about Rv1591/MT1626 before designing experiments

  • Consider appropriate control groups and technical replicates

  • Plan for statistical analysis during experimental design phase

Methodological approach: Apply the FINERMAPS criteria (Feasible, Interesting, Novel, Ethical, Relevant, Manageable, Appropriate, Potential value, Publishability, and Systematic) when formulating research questions about Rv1591/MT1626 . For characterizing this protein:

  • Begin with feasibility assessment - ensure required resources and expertise are available

  • Design experiments with appropriate controls (e.g., known proteins with similar characteristics)

  • Determine appropriate sample sizes using statistical power calculations

  • Consider factorial experimental designs to efficiently test multiple variables simultaneously

What purification strategies are most effective for Rv1591/MT1626?

Purification strategy development requires consideration of protein characteristics:

  • Affinity chromatography leveraging fusion tags (His, GST) offers specific capture

  • Size exclusion chromatography provides final polishing and oligomeric state assessment

  • Special considerations may be needed if Rv1591/MT1626 is intrinsically disordered

Methodological approach: Develop a multi-step purification protocol. If Rv1591/MT1626 exhibits properties similar to the natively unfolded protein Rv1211 , employ techniques suitable for intrinsically disordered proteins:

  • Use denaturing conditions if necessary for initial extraction

  • Employ immobilized metal affinity chromatography with optimized buffers

  • Include stabilizing agents to prevent aggregation

  • Verify purity using SDS-PAGE and integrity using mass spectrometry

How can binding interactions of Rv1591/MT1626 be characterized?

Identifying and characterizing binding partners provides functional insights:

  • Thermal shift assays offer initial screening for potential ligands

  • Isothermal titration calorimetry (ITC) provides detailed thermodynamic parameters

  • NMR spectroscopy can map binding interfaces at atomic resolution

Methodological approach: Drawing from the approach used to study Rv1211-trifluoperazine interaction , employ a multi-technique strategy:

  • Screen potential binding partners using thermal shift assays

  • Confirm binding using ITC to determine stoichiometry, affinity, and thermodynamics

  • Analyze binding interfaces using NMR chemical shift perturbation experiments

  • Consider the potential for "fuzzy" interactions if Rv1591/MT1626 is intrinsically disordered

How can the role of Rv1591/MT1626 in M. tuberculosis pathogenesis be determined?

Understanding pathogenic relevance requires specialized approaches:

  • Gene knockout or knockdown studies assess essentiality

  • Transcriptional profiling during infection reveals expression patterns

  • Animal infection models evaluate virulence contribution

Methodological approach: Design a systematic research plan with appropriate controls:

  • Generate knockout or conditional mutant strains

  • Characterize growth phenotypes under various stress conditions

  • Assess virulence in cellular and animal infection models

  • Perform complementation studies to confirm phenotype specificity

What computational approaches can predict functional domains in Rv1591/MT1626?

Bioinformatic analysis provides initial functional hypotheses:

  • Hidden Markov Models identify remote homologs and domain architectures

  • Structural modeling may reveal functional sites

  • Genomic context analysis suggests functional associations

Methodological approach: Apply an integrative computational strategy combining:

  • Sequence-based analysis (BLAST, Pfam, InterPro)

  • Structure prediction using multiple algorithms

  • Genomic neighborhood analysis

  • Co-expression data mining

How can post-translational modifications of Rv1591/MT1626 be characterized?

Post-translational modifications often regulate protein function:

  • Mass spectrometry identifies modification types and sites

  • Site-directed mutagenesis assesses functional significance

  • Antibodies against specific modifications enable detection in native context

Methodological approach: Develop a systematic workflow:

  • Enrich for modified protein forms using affinity techniques

  • Perform high-resolution mass spectrometry

  • Validate findings using site-specific antibodies or chemical probes

  • Assess functional impact through mutagenesis studies

How should contradictory results in Rv1591/MT1626 characterization be resolved?

Conflicting findings require systematic evaluation and resolution:

  • Methodological differences often explain contradictions

  • Protein preparation variations can affect structure and function

  • Environmental conditions influence protein behavior

Methodological approach: When encountering contradictory results:

  • Critically evaluate experimental conditions and methodologies

  • Design experiments to directly test competing hypotheses

  • Consider factorial experimental designs to identify interacting variables

  • Use statistical methods to quantify confidence in different models

What statistical approaches are appropriate for analyzing Rv1591/MT1626 experimental data?

  • Experimental design dictates appropriate statistical tests

  • Multiple hypothesis testing requires correction methods

  • Data visualization aids interpretation and communication

Methodological approach: Statistical analysis should be planned during experimental design:

  • Determine appropriate sample sizes using power analysis

  • Apply suitable statistical tests based on data distribution and experimental design

  • Use multiple comparison corrections when testing many hypotheses

  • Consider applying robust statistical methods when dealing with outliers

How can protein-protein interaction data for Rv1591/MT1626 be validated?

Interaction validation requires multiple orthogonal approaches:

  • Reciprocal co-immunoprecipitation confirms direct interactions

  • Proximity labeling methods identify interaction contexts

  • Functional assays assess biological relevance

Methodological approach: Design a validation pipeline:

  • Perform initial screening using high-throughput methods

  • Validate promising interactions using multiple orthogonal techniques

  • Characterize interaction domains through truncation/mutation studies

  • Assess functional significance using genetic or pharmacological perturbations

How can structural studies of Rv1591/MT1626 inform functional hypotheses?

Structure-function analysis bridges structural biology and biochemistry:

  • Conserved structural motifs suggest potential functions

  • Active site architecture indicates catalytic mechanisms

  • Binding pockets inform potential ligand interactions

Methodological approach: Integrate structural and functional analyses:

  • Begin with computational structural predictions

  • Validate using experimental techniques (CD, NMR, X-ray crystallography)

  • Identify potential functional sites based on structural features

  • Design targeted functional assays based on structural insights

Similar to the approach used with Rv1211 , determine if Rv1591/MT1626 adopts a folded structure or exhibits intrinsic disorder, as this fundamentally impacts functional mechanisms.

What approaches can determine if Rv1591/MT1626 has enzymatic activity?

Enzymatic characterization requires systematic screening:

  • Activity-based protein profiling identifies enzyme class

  • Substrate screening assesses catalytic capabilities

  • Kinetic analysis quantifies enzymatic parameters

Methodological approach: Develop a comprehensive screening strategy:

  • Perform bioinformatic analysis to predict potential enzyme class

  • Design a panel of assays covering predicted activities

  • Analyze reaction products using sensitive analytical techniques

  • Determine enzyme kinetics for identified substrates

Potential ActivityAssay MethodSubstrateDetection MethodActivity (Units)
HydrolasepH-statVarious esterspH indicatorTo be determined
TransferaseCoupled assayPotential donorsSpectrophotometricTo be determined
OxidoreductaseO₂ consumptionVarious substratesElectrodeTo be determined
Ligand bindingITCPotential ligandsHeat changeTo be determined

How can the impact of environmental conditions on Rv1591/MT1626 structure-function be assessed?

Environmental responsiveness may indicate regulatory roles:

  • pH, temperature, and ionic conditions affect protein structure

  • Ligand binding may induce conformational changes

  • Redox conditions can modulate activity

Methodological approach: Systematically test environmental variables:

  • Characterize protein stability across pH, temperature, and ionic strength ranges

  • Assess structural changes using spectroscopic techniques

  • Measure functional parameters under varying conditions

  • Identify physiologically relevant conditions that modulate activity

What is the potential of Rv1591/MT1626 as a diagnostic biomarker for tuberculosis?

Diagnostic applications require specific characteristics:

  • Expression during infection

  • Accessibility to detection methods

  • Specificity to pathogenic mycobacteria

  • Correlation with disease states

Methodological approach: Evaluate diagnostic potential through:

  • Expression analysis during different infection stages

  • Immunogenicity assessment in patient cohorts

  • Development of detection methods (ELISA, aptamers)

  • Clinical sample testing with statistical validation of performance metrics

How can Rv1591/MT1626 be evaluated as a potential drug target?

Target validation requires multiple lines of evidence:

  • Essentiality for bacterial survival or virulence

  • Druggability assessment

  • Selective inhibition potential

  • Resistance development risk

Methodological approach: Similar to studies with other M. tuberculosis proteins that bind small molecules (like Rv1211's interaction with trifluoperazine ):

  • Establish essentiality through genetic approaches

  • Identify binding pockets through structural studies

  • Screen for inhibitors using biochemical or cell-based assays

  • Validate hits through orthogonal methods

What approaches can identify inhibitors of Rv1591/MT1626 function?

Inhibitor discovery employs multiple strategies:

  • High-throughput screening of chemical libraries

  • Fragment-based drug discovery

  • Structure-based virtual screening

  • Repurposing of known antimicrobials

Methodological approach: Develop a comprehensive screening cascade:

  • Select appropriate screening methodology based on protein function

  • Implement proper statistical design for screening experiments

  • Validate hits through dose-response and specificity testing

  • Characterize mechanism of action for promising compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.