Recombinant Uncharacterized protein Rv1824/MT1872 (Rv1824, MT1872)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Target Names
Rv1824, MT1872
Target Protein Sequence
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG A
Uniprot No.

Q&A

What is Rv1824/MT1872 protein?

Rv1824/MT1872 is an uncharacterized protein from Mycobacterium tuberculosis, the causative agent of tuberculosis. This protein has been identified through genomic analysis but its specific function remains largely unknown. As an uncharacterized protein, it represents an opportunity for novel discovery in tuberculosis research, potentially offering insights into M. tuberculosis pathogenicity or survival mechanisms.

Where is Rv1824 found in Mycobacterium tuberculosis?

Rv1824 is encoded in the genome of Mycobacterium tuberculosis. M. tuberculosis is an obligately aerobic bacterium with an optimal growth temperature of 37°C that does not grow below 30°C. The bacterium primarily affects the lungs, causing pulmonary tuberculosis, but can invade other organs as well. While the specific cellular localization of Rv1824 is not fully characterized, understanding its location (whether cytoplasmic, membrane-associated, or secreted) would provide valuable clues about its function.

How is recombinant Rv1824 protein typically produced for research?

Recombinant Rv1824 protein can be produced using several expression systems including E. coli, yeast, baculovirus, or mammalian cells. The choice of expression system depends on research requirements such as post-translational modifications, solubility, and yield. For basic structural studies, E. coli expression is often preferred due to its simplicity and high yield, while mammalian expression systems might be chosen when native folding and post-translational modifications are critical. The recombinant protein typically includes the amino acid sequence 1-121 of the native protein and may be tagged for purification purposes.

What are the recommended protocols for purifying recombinant Rv1824 protein?

For purification of recombinant Rv1824 protein, researchers typically employ a multi-step approach:

  • Express the protein with an affinity tag (His-tag, GST, etc.) in the appropriate expression system

  • Lyse cells under conditions that maintain protein stability

  • Perform initial purification using affinity chromatography

  • Apply secondary purification methods such as ion-exchange or size-exclusion chromatography

  • Validate purity using SDS-PAGE and Western blotting

  • Confirm protein identity using mass spectrometry

Optimization of buffer conditions is crucial for maintaining stability of Rv1824 during purification, as uncharacterized proteins may have unknown stability properties. Researchers should test various pH ranges and salt concentrations to determine optimal conditions.

How can I design effective expression constructs for Rv1824 studies?

When designing expression constructs for Rv1824 studies, consider:

  • Codon optimization for your expression system

  • Selection of appropriate fusion tags (His, GST, MBP) that may improve solubility

  • Inclusion of protease cleavage sites for tag removal

  • Consideration of full-length vs. truncated constructs

  • Analysis of predicted structural domains to inform construct boundaries

  • Incorporation of promoters appropriate for the expression system

For challenging proteins like Rv1824, it's advisable to prepare multiple constructs with different tags and boundaries to increase the likelihood of successful expression and purification. Testing expression in small-scale cultures before scaling up can save resources and time.

What mass spectrometry approaches are most effective for studying Rv1824?

For studying Rv1824 protein, several mass spectrometry approaches have proven effective:

  • Discovery-based proteomics using LC-MS/MS for initial identification and characterization

  • Selected Reaction Monitoring (SRM) for targeted quantification

  • Multiple Reaction Monitoring (MRM) for sensitive detection in complex samples

SRM assays are particularly valuable as they allow for the verification of the presence or absence of specific M. tuberculosis proteins in any sample type. When designing MS experiments for Rv1824, researchers should:

  • Select unique peptides that specifically identify Rv1824

  • Optimize collision energies for chosen peptides

  • Develop appropriate internal standards for quantification

  • Consider sample preparation methods that maximize protein recovery

These targeted approaches can detect Rv1824 even when present at low abundance, making them valuable for studies of clinical samples.

How does Rv1824 expression vary across different M. tuberculosis strains?

Analysis of Rv1824 expression across different M. tuberculosis strains requires comprehensive proteomic approaches. Based on similar studies with other M. tuberculosis proteins, researchers should:

  • Select diverse clinical isolates representing different lineages and drug resistance profiles

  • Grow cultures under standardized conditions

  • Extract total protein using methods that ensure complete lysis of the mycobacterial cell wall

  • Perform MS1-based label-free quantification to assess expression levels

  • Validate findings using targeted SRM assays

Previous proteomic studies comparing virulent and avirulent mycobacterial strains have shown that protein expression can vary significantly despite high genomic similarity. This suggests that Rv1824 expression levels might differ between strains with diverse clinical phenotypes, potentially correlating with virulence characteristics.

What approaches can be used to investigate potential binding partners of Rv1824?

To investigate potential binding partners of Rv1824, researchers can employ several complementary approaches:

  • Pull-down assays using tagged recombinant Rv1824 as bait

  • Yeast two-hybrid screening against a M. tuberculosis library

  • Co-immunoprecipitation with antibodies against Rv1824

  • Proximity labeling methods such as BioID or APEX

  • Crosslinking mass spectrometry to identify transient interactions

  • Surface plasmon resonance to confirm and quantify specific interactions

When analyzing results, it's essential to include appropriate controls to distinguish true interactions from background binding. Validation of key interactions using multiple methods increases confidence in the findings. Functional studies of identified partners can provide insights into the biological role of Rv1824.

How might knockout or knockdown of Rv1824 affect M. tuberculosis virulence?

Based on studies of other M. tuberculosis proteins, investigating the effects of Rv1824 knockout or knockdown would provide valuable insights into its function. Researchers could:

  • Generate knockout strains using specialized mycobacterial genetic tools (e.g., specialized transduction, CRISPR-Cas9)

  • Create conditional knockdown strains if Rv1824 is essential

  • Assess growth kinetics in various media conditions

  • Evaluate survival under stress conditions (oxidative stress, nutrient deprivation, etc.)

  • Test virulence in cellular and animal infection models

  • Compare transcriptomic and proteomic profiles between wild-type and mutant strains

Similar approaches with other M. tuberculosis proteins have revealed their roles in pathogenesis. For example, deletion of the RD1 region (containing genes for ESAT-6 and CFP-10) results in attenuated virulence, demonstrating how genetic modifications can reveal protein function. If Rv1824 is involved in virulence, changes in phenotypes such as survival within macrophages, cytokine responses, or persistence in animal models might be observed.

How should researchers analyze differential expression of Rv1824 across experimental conditions?

When analyzing differential expression of Rv1824 across experimental conditions, researchers should:

  • Use appropriate statistical methods for the specific experimental design

  • Apply multiple testing corrections when comparing across numerous conditions

  • Establish clear thresholds for significance based on both statistical significance and fold-change

  • Validate findings using orthogonal methods (e.g., RT-qPCR, Western blotting)

  • Place expression changes in biological context by examining co-regulated genes/proteins

For proteomic data specifically, normalization approaches should account for the complexity of the mycobacterial proteome. When using SRM for targeted analysis, include appropriate reference peptides and internal standards to ensure accurate quantification. Integrating transcriptomic and proteomic data can provide a more comprehensive view of Rv1824 regulation.

What bioinformatic approaches can predict potential functions of Rv1824?

For uncharacterized proteins like Rv1824, several bioinformatic approaches can provide functional insights:

  • Sequence homology searches across bacterial species

  • Structural prediction using tools like AlphaFold or RoseTTAFold

  • Domain and motif analysis to identify functional elements

  • Genomic context analysis (examining neighboring genes)

  • Co-expression network analysis

  • Evolutionary conservation patterns

These computational approaches can generate testable hypotheses about Rv1824 function. For example, if structural predictions suggest similarity to known virulence factors or if genomic context places it near genes involved in specific pathways, these provide directions for experimental validation.

How can researchers effectively compare Rv1824 expression data with existing M. tuberculosis strain typing information?

To effectively compare Rv1824 expression data with strain typing information, researchers should:

  • Select strains that have been comprehensively typed using methods such as:

    • IS6110 restriction fragment length polymorphism (RFLP)

    • Spoligotyping

    • Mycobacterial Interspersed Repetitive Units-Variable Number Tandem Repeats (MIRU-VNTR)

    • Large sequence polymorphism (LSP) analysis

  • Integrate expression data with typing information in a structured database

  • Apply multivariate statistical methods to identify correlations between:

    • Expression patterns

    • Genetic lineages

    • Clinical phenotypes (virulence, drug resistance, etc.)

  • Validate findings across independent strain collections

This approach can reveal whether Rv1824 expression correlates with specific genetic backgrounds or phenotypic traits, potentially providing insights into its role in strain-specific characteristics of M. tuberculosis.

What is the potential of Rv1824 as a biomarker for tuberculosis diagnosis or treatment monitoring?

Assessing Rv1824 as a potential biomarker requires systematic evaluation:

  • Determine whether Rv1824 is:

    • Consistently expressed across diverse clinical isolates

    • Detectable in patient samples (sputum, blood, etc.)

    • Differentially expressed during active vs. latent infection

    • Modulated in response to treatment

  • Develop sensitive and specific detection methods:

    • ELISA-based approaches for protein detection

    • PCR-based methods for transcript detection

    • Targeted mass spectrometry assays (SRM/MRM)

  • Validate in diverse patient populations:

    • Different geographical regions

    • Various TB manifestations (pulmonary, extrapulmonary)

    • Comorbidities (HIV co-infection, diabetes)

Preliminary proteomics studies have shown that targeted assays like SRM can reliably detect M. tuberculosis proteins in clinical samples, suggesting this approach could be applied to evaluate Rv1824 as a biomarker.

How might understanding Rv1824 contribute to tuberculosis vaccine development?

Understanding Rv1824 could contribute to vaccine development through several pathways:

  • If Rv1824 proves to be immunogenic:

    • It could be evaluated as a potential vaccine antigen

    • Its epitopes could be incorporated into subunit or peptide vaccines

    • It might serve as a component in multi-antigen formulations

  • If Rv1824 is involved in virulence:

    • Attenuated strains with modified Rv1824 could be developed

    • Understanding its mechanism could inform rational vaccine design

    • It might represent a target for adjuvant development

  • If Rv1824 shows conservation across strains:

    • It could provide broad protection against diverse M. tuberculosis lineages

    • Its evolutionary stability might make it less prone to vaccine escape

The history of BCG vaccine development demonstrates how understanding specific proteins (like those in the RD1 region) can lead to attenuated strains useful for vaccination. Similar approaches with Rv1824 could be pursued if research reveals appropriate characteristics.

What role might Rv1824 play in M. tuberculosis drug resistance mechanisms?

Investigating Rv1824's potential role in drug resistance would involve:

  • Comparing expression levels between:

    • Drug-sensitive and resistant clinical isolates

    • Laboratory strains before and after induction of resistance

    • Patient samples pre- and post-treatment failure

  • Testing whether Rv1824 modification affects:

    • Minimum inhibitory concentrations of first- and second-line TB drugs

    • Rate of resistance development under drug pressure

    • Cross-resistance patterns across drug classes

  • Exploring potential mechanisms such as:

    • Direct drug binding or modification

    • Alteration of cell wall permeability

    • Involvement in stress response pathways

    • Participation in efflux mechanisms

M. tuberculosis is prone to developing drug resistance through both spontaneous mutation (primary resistance) and mutation selection (secondary resistance). Understanding whether Rv1824 contributes to these processes could inform strategies to prevent or overcome resistance.

What are the major technical challenges in expressing and purifying Rv1824 for structural studies?

Structural studies of Rv1824 face several technical challenges:

  • Expression challenges:

    • Potential toxicity to expression hosts

    • Inclusion body formation requiring refolding

    • Low expression levels necessitating optimization

    • Codon usage differences between M. tuberculosis and expression hosts

  • Purification challenges:

    • Maintaining protein stability during purification

    • Obtaining sufficient purity for structural studies

    • Preventing aggregation or precipitation

    • Removing bacterial endotoxins for functional studies

  • Structural analysis challenges:

    • Obtaining crystals suitable for X-ray crystallography

    • Achieving sufficient concentration for NMR studies

    • Determining optimal buffer conditions for structural integrity

    • Interpreting structures of proteins with no known homologs

Researchers should consider screening multiple expression constructs, purification conditions, and structural analysis methods to overcome these challenges.

How can researchers overcome difficulties in detecting low-abundance Rv1824 in complex samples?

Detecting low-abundance Rv1824 in complex samples requires specialized approaches:

  • Sample enrichment strategies:

    • Immunoaffinity purification using anti-Rv1824 antibodies

    • Subcellular fractionation to concentrate relevant compartments

    • Protein fractionation based on physicochemical properties

  • Enhanced detection methods:

    • Selected Reaction Monitoring (SRM) mass spectrometry

    • Multiple Reaction Monitoring (MRM) for targeted quantification

    • Amplification-based techniques for increased sensitivity

    • Nested PCR approaches for transcript detection

  • Signal enhancement approaches:

    • Enzyme-linked signal amplification in immunoassays

    • Digital PCR for absolute quantification

    • Mass cytometry for single-cell analysis

SRM assays have been successfully applied to detect M. tuberculosis proteins across diverse strain types, making this a promising approach for Rv1824 detection even at low abundance.

What controls should be included when studying potential interactions of Rv1824 with host immune components?

When studying Rv1824 interactions with host immune components, include these essential controls:

  • Protein quality controls:

    • Heat-denatured Rv1824 to control for non-specific interactions

    • Irrelevant M. tuberculosis proteins of similar size/structure

    • Tag-only controls if using tagged recombinant proteins

    • Endotoxin testing to exclude LPS-mediated effects

  • Host component controls:

    • Cells from multiple donors to account for genetic variation

    • Blocking studies to confirm specificity of interactions

    • Dose-response analysis to establish physiological relevance

    • Time-course studies to differentiate primary and secondary effects

  • Experimental system controls:

    • Appropriate vehicle controls

    • Positive controls using known immunomodulatory proteins

    • Negative controls using non-immunogenic proteins

    • System validation using established host-pathogen interactions

These controls help distinguish true biological interactions from experimental artifacts, ensuring reliable and reproducible findings that can guide further research on Rv1824's role in host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.