Recombinant Uncharacterized protein Rv1989c/MT2043 (Rv1989c, MT2043)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Protein Rv1989c/MT2043

Recombinant Uncharacterized protein Rv1989c/MT2043, also referred to as Rv1989c or MT2043, is a protein that has been identified in Mycobacterium tuberculosis (Mtb) . Characterized as an uncharacterized protein, research has shed light on its function as a toxin within a type II toxin-antitoxin (TA) system .

Genomic and Bioinformatic Analysis

  • Identification and Classification The Rv1989c-Rv1990c TA module was identified through in silico genomic analysis of prokaryotic TA loci and categorized as a COG5654-COG5642 TA system . This system is predicted to encode a RES domain-containing toxin (Rv1989c) and a cognate antitoxin with an XRE-like HTH domain (Rv1990c) .

  • Domain Architecture Analysis using SMART revealed three conserved polar groups (Arg47, Glu69, and Ser126) in Rv1989c, which are predicted to form an active site .

  • Distribution Rv1989c-Rv1990c-like TA systems are found in multiple mycobacterial species within the M. tuberculosis complex and, to a limited extent, in opportunistic non-tuberculous mycobacteria such as M. avium . Homologs are also present in environmental prokaryotes like Gordonia spp .

Role in Toxin-Antitoxin (TA) System

  • TA System Rv1989c functions as a toxin, and its activity is regulated by a co-expressed antitoxin protein, Rv1990c . The antitoxin binds to and sequesters the toxin protein .

  • Upregulation Under Stress The Rv1989c-Rv1990c TA system is significantly upregulated under various stress conditions, including in Mtb persister cells, during hypoxic stress, under starvation, and within host macrophages .

  • Nomenclature Given its function as a mycobacterial cidal toxin, Rv1989c has been named MbcT, with its antitoxin Rv1990c named MbcA .

Functional Characterization of Rv1989c

  • Bactericidal Activity Studies have demonstrated that Rv1989c exhibits bactericidal activity in M. tuberculosis .

  • Crystal Structure of MbcTA Complex The crystal structure of the MbcTA complex reveals a donut-like structure composed of three heterotetrameric MbcTA complexes .

Molecular Mechanisms of Rv1989c

  • NAD+ Phosphorylase Activity Rv1989c encodes a novel NAD+ phosphorylase, an enzymatic activity not previously described .

  • Mutational Analysis Mutational analysis has shown that specific residues, such as Arg27, Arg47, and Tyr58, are crucial for MbcT-catalyzed growth inhibition . Ser126 was found to be non-essential for toxicity, while MbcT-Y28A and MbcT-E69A retained limited toxin activity .

Tables

Table 1: Crystallographic Data Collection and Refinement Statistics for MbcTA Complex
Value
Space groupP21
Cell dimensions
a, b, c (Å)114.2,73.8,118.6
α, β, γ (°)90, 95.4, 90
Wavelength (Å)0.9793
Resolution (Å)3.06
Reflections
Total number of reflections620,194
Unique reflections62,157
R work (%)16.23
R free (%)21.11
No. atoms
Total4,865
Macromolecules4,569
Ligands18
Waters278
No. protein residues589
B-factors b (Å2)
Macromolecules42.4
Solvent62.8
RMSD b
Bond lengths (Å)0.007
Bond angles (°)0.990
Ramachandran c (%)
Most favored99.0
Allowed1.0
Outliers0.0
Table 2: Molecular Mass Determination of MbcTA
Value
MM (from Porod volume) (kDa) POROD154 ± 15
MM (from saxs I(0), kDa)110 ± 20
MM DAM (from bead model, kDa)170 ± 35
Calculated monomeric MM from sequence (kDa)197.2

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Target Names
Rv1989c, MT2043
Target Protein Sequence
MSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLA DSAQACMVEVERAAQAASTTAEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDI YGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQRTRPGQLQLRQSVDLTPALY QELRAT
Uniprot No.

Q&A

What is Rv1989c and how is it classified in Mycobacterium tuberculosis?

Rv1989c is a protein encoded by Mycobacterium tuberculosis that functions as part of a toxin-antitoxin (TA) system, specifically paired with Rv1990c. It belongs to an unclassified group of TA systems in M. tuberculosis and is one of the three TA systems likely to exhibit bactericidal rather than bacteriostatic activity, based on the essentiality of its corresponding antitoxin gene . Unlike conventional toxins, Rv1989c does not bear homology to well-characterized proteins, suggesting it employs an unconventional toxin mechanism that warrants further investigation.

What is known about the structural properties of Rv1989c?

The structural properties of Rv1989c remain largely uncharacterized, placing it in contrast to other well-studied TA toxins like VapC that contain identifiable PIN domains with ribonuclease activity. The lack of homology to characterized proteins complicates structural prediction and necessitates experimental approaches such as X-ray crystallography or cryo-electron microscopy to determine its three-dimensional structure . This structural uniqueness may correlate with a novel mechanism of toxicity that differs from the translation inhibition typically observed in other toxin families.

How does the Rv1989c-Rv1990c pair differ from conventional TA systems in M. tuberculosis?

The Rv1989c-Rv1990c system differs from conventional TA systems in several aspects:

  • Bactericidal activity: Unlike most TA systems that induce bacteriostasis, Rv1989c is likely bactericidal, capable of causing mycobacterial cell death rather than just growth arrest

  • Antitoxin essentiality: The antitoxin Rv1990c is essential for M. tuberculosis viability, whereas most antitoxins are non-essential

  • Structural uniqueness: It does not conform to the major TA families (e.g., VapBC, MazEF, HigBA) that predominate in M. tuberculosis

  • Classification: It belongs to the "unclassified" category among the 79+ TA systems identified in M. tuberculosis H37Rv

What expression systems are most suitable for producing recombinant Rv1989c for structural studies?

For recombinant Rv1989c production, Escherichia coli-based expression systems with tight regulation are most suitable due to the potential toxicity of Rv1989c. Methodological considerations include:

  • Inducible expression systems: The pET system with T7 RNA polymerase control or specialized systems like BL21(DE3)pLysS to minimize leaky expression

  • Co-expression with antitoxin: Co-expressing Rv1990c antitoxin to neutralize toxicity during production

  • Fusion tags: Addition of solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) to improve protein folding and purification

  • Codon optimization: Adapting the Rv1989c sequence to E. coli codon usage to enhance expression levels

  • Growth conditions: Low-temperature expression (16-18°C) post-induction to promote proper folding

These approaches must be empirically tested as the unconventional nature of Rv1989c may require customized expression protocols.

What are the methodological challenges in studying the biochemical activity of Rv1989c?

Studying Rv1989c's biochemical activity presents several methodological challenges:

  • Unknown mechanism: Without homology to characterized proteins, potential substrates or activity assays must be determined empirically

  • Conditional expression: Designing systems for controlled expression to observe effects before cell death occurs

  • Target identification: Determining the cellular targets requires unbiased approaches such as metabolomic or proteomic comparisons

  • Activity reconstitution: Establishing in vitro assays is challenging without knowing the substrate or cofactors required

  • Structural dependencies: The active conformation may depend on specific conditions (pH, ion concentration, redox state) that need to be identified

A systematic approach combining transcriptomics, proteomics, and metabolomics under controlled Rv1989c expression conditions represents the most promising strategy to identify its biochemical activity and cellular targets.

What is the proposed role of Rv1989c in M. tuberculosis persistence?

The Rv1989c-Rv1990c system likely contributes to M. tuberculosis persistence through several possible mechanisms:

  • Stress response: It may function as a stress-response element that helps the bacterium adapt to hostile host environments

  • Population heterogeneity: The system could generate subpopulations with different growth states, enhancing survival under antibiotic pressure

  • Programmed cell death: Under extreme stress, activation of bactericidal toxins like Rv1989c may trigger altruistic cell death to release nutrients for surviving bacteria

  • Host-pathogen interactions: The system may influence interactions with host immune cells by modulating bacterial physiology

  • Persistence state transition: It may participate in the complex regulatory network controlling transition into and out of persistence states

The unusually high number of TA systems in M. tuberculosis (79+) compared to related species like M. marinum (<10) suggests these systems played a crucial evolutionary role in the adaptation of M. tuberculosis to its human host niche .

How does the Rv1989c-Rv1990c TA system respond to different stress conditions?

Stress ConditionPredicted Rv1989c-Rv1990c ResponseResearch Method
HypoxiaPotential upregulation based on the role of TA systems in dormancyRNA-seq, qRT-PCR
Nutrient starvationLikely activation as nutrient limitation is a key persistence triggerProteomics, transcriptomics
Oxidative stressPossible involvement in damage responseRedox proteomics
Antibiotic exposureMay contribute to survival of persister subpopulationsPersister assays, survival curves
Acidic pHPotential role in phagosomal survivalpH-controlled expression studies
Immune effectorsResponse to host defense molecules unknownInfection models, immunology assays

Comprehensive stress response profiling would require controlled expression systems and comparative omics approaches to identify condition-specific activation patterns.

What techniques are most effective for resolving conflicts between structural predictions and experimental findings for Rv1989c?

When addressing discrepancies between structural predictions and experimental findings for unconventional proteins like Rv1989c, researchers should follow this methodological approach:

  • Evaluate prediction reliability:

    • Assess confidence scores of structural prediction algorithms

    • Compare predictions from multiple independent methods

    • Identify consensus structural elements versus divergent predictions

  • Design targeted experimental validation:

    • Use site-directed mutagenesis to test the functional importance of predicted structural elements

    • Apply limited proteolysis to identify structured domains

    • Employ circular dichroism spectroscopy to confirm secondary structure composition

  • Integrate multiple structural techniques:

    • Combine X-ray crystallography for high-resolution static structure

    • Use nuclear magnetic resonance (NMR) for dynamic information

    • Apply small-angle X-ray scattering (SAXS) for solution conformations

  • Analyze conflicting evidence systematically:

    • Evaluate the internal and external validity of experimental approaches

    • Consider if differences reflect true structural flexibility or methodological limitations

    • Develop a framework for weighted integration of multiple evidence sources

  • Computational refinement:

    • Use molecular dynamics simulations to test structural stability

    • Apply enhanced sampling techniques to explore conformational space

    • Validate with experimental data in an iterative approach

This integrated strategy helps resolve conflicts while avoiding overreliance on any single method for this challenging uncharacterized protein.

How can researchers differentiate between direct and indirect effects when studying Rv1989c toxicity?

Differentiating between direct and indirect effects of Rv1989c toxicity requires a systematic approach:

  • Temporal resolution studies:

    • Use time-course experiments with early sampling points after Rv1989c induction

    • Apply kinetic modeling to identify primary versus secondary events

    • Implement pulse-chase experiments to track progression of cellular effects

  • Dose-dependency analysis:

    • Establish titratable expression systems to correlate Rv1989c levels with effects

    • Identify threshold concentrations for various cellular responses

    • Determine if effects show proportional or threshold responses

  • Direct target identification:

    • Apply crosslinking coupled to mass spectrometry to capture direct binding partners

    • Use activity-based protein profiling if enzymatic activity is suspected

    • Implement CRISPR interference screens to identify genes affecting sensitivity

  • Reconstitution experiments:

    • Develop in vitro systems with purified components to test direct activity

    • Progressively add cellular components to identify minimal requirements

    • Compare cell-free and cellular phenotypes

  • Control experiments:

    • Use catalytically inactive mutants (once active site is identified)

    • Compare with other toxins having known mechanisms

    • Implement parallel-pathway inhibition to test for synergistic effects

These approaches collectively enable discrimination between primary toxicity mechanisms and downstream cellular responses.

What techniques are most appropriate for studying the regulation of the Rv1989c-Rv1990c operon in M. tuberculosis?

Studying the regulation of the Rv1989c-Rv1990c operon requires specialized techniques suitable for mycobacteria:

  • Promoter mapping and characterization:

    • 5' RACE (Rapid Amplification of cDNA Ends) to identify transcription start sites

    • Reporter fusions (GFP, luciferase) to monitor promoter activity

    • Chromatin immunoprecipitation (ChIP) to identify regulatory protein binding

  • Transcriptional analysis:

    • Quantitative RT-PCR for targeted analysis under various conditions

    • RNA-seq for genome-wide expression context

    • Northern blotting to identify operon structure and potential processing

  • Translational regulation:

    • Ribosome profiling to assess translation efficiency

    • Western blotting with specific antibodies for protein levels

    • Mass spectrometry for absolute quantification

  • Regulatory network analysis:

    • Conditional expression of potential regulators

    • DNA-protein interaction studies (EMSA, footprinting)

    • Systematic mutation of predicted regulatory elements

  • Single-cell approaches:

    • Fluorescent reporters to monitor cell-to-cell variability

    • Time-lapse microscopy to track expression dynamics

    • Flow cytometry for population heterogeneity analysis

These methods should be applied across relevant stress conditions to comprehensively map the regulatory landscape of this important TA system.

What is the expression profile of Rv1989c across different growth phases and infection models?

The expression profile of Rv1989c varies across growth phases and infection models, though comprehensive data remains limited. Based on patterns observed for other TA systems in M. tuberculosis:

Growth Phase/Infection ModelExpected Rv1989c ExpressionBiological Significance
Exponential growth (in vitro)Likely low basal expressionMinimal role during active replication
Stationary phasePotential upregulationPreparation for stress conditions
Hypoxic conditions (Wayne model)Possible inductionAdaptation to oxygen limitation in granulomas
Nutrient starvationLikely increased expressionResponse to host nutrient restriction
Macrophage infection (early)Expression patterns unknownPotential role in initial adaptation
Macrophage infection (persistent)Potential upregulationContribution to intracellular survival
Animal models (acute phase)Requires investigationMay differ between infection models
Animal models (chronic phase)Potential role in persistenceContributes to long-term survival
Human clinical samplesLimited data availableExpression in human disease unknown

Comprehensive transcriptomic and proteomic studies across these conditions would help elucidate the precise role of this TA system in the M. tuberculosis lifecycle .

How does Rv1989c compare to other toxins in M. tuberculosis toxin-antitoxin systems?

Rv1989c presents several distinctive features when compared to other M. tuberculosis toxins:

TA FamilyRepresentative ExamplesToxin MechanismComparison to Rv1989c
VapBCVapC (47 members)PIN domain ribonucleases targeting mRNA, rRNA, or tRNARv1989c lacks PIN domain and has no identified ribonuclease motifs
MazEFMazF (10 members)Sequence-specific endoribonucleasesNo sequence similarity with Rv1989c; different target specificity expected
HigBAHigB (3 members)mRNA cleavage affecting translationRv1989c has no established ribonuclease activity
RelBERelE (2 members)Cleaves mRNA in ribosomal A-siteMechanism of Rv1989c appears distinct from translation interference
ParDEParE (2 members)DNA gyrase inhibitorNo evidence for DNA gyrase interaction with Rv1989c
DarTGDarT/DarG (1 system)ADP-ribosylates single-stranded DNARv1989c shows no homology to ADP-ribosyltransferases
UnclassifiedRv1989c-Rv1990cUnknown, potentially bactericidalUnique: belongs to 7 unclassified TA systems with no established mechanism

This comparison highlights that Rv1989c likely employs a unique mechanism of action that has not been characterized in other bacterial toxins, making it particularly interesting for novel antimycobacterial approaches.

What evolutionary insights can be gained from comparative genomic analysis of Rv1989c across mycobacterial species?

Comparative genomic analysis of Rv1989c across mycobacterial species reveals important evolutionary patterns:

  • Distribution pattern:

    • Highly restricted to the M. tuberculosis complex (MTBC)

    • Absent or divergent in non-pathogenic mycobacteria

    • May represent a pathogen-specific adaptation

  • Conservation analysis:

    • Sequence conservation within MTBC suggests functional importance

    • Non-synonymous to synonymous substitution ratios can indicate selection pressure

    • Identification of conserved residues critical for function

  • Genomic context:

    • Associated with genomic islands or mobile genetic elements

    • Potential horizontal gene transfer history

    • Co-evolution with partner antitoxin Rv1990c

  • Evolutionary significance:

    • The dramatic expansion of TA systems in M. tuberculosis (79+) compared to related species like M. marinum (<10) indicates these systems played crucial roles in the evolution and adaptation of M. tuberculosis to its human host niche

    • Rv1989c may represent a relatively recent acquisition that contributed to virulence or persistence capabilities

  • Structural evolution:

    • Identification of structural homologs in distant bacteria may provide functional hints

    • Analysis of protein domain architecture for modular evolution

    • Investigation of potential neofunctionalization events

This evolutionary context provides valuable clues about the biological significance and specialized functions of Rv1989c in mycobacterial pathogenesis.

What approaches can researchers use to evaluate Rv1989c as a potential drug target?

Evaluating Rv1989c as a drug target requires a systematic approach:

  • Target validation:

    • Confirm essentiality through conditional knockdown/knockout studies

    • Demonstrate role in virulence and persistence using animal models

    • Evaluate contribution to antibiotic tolerance phenotypes

  • Druggability assessment:

    • Structural characterization to identify potential binding pockets

    • In silico evaluation of physicochemical properties favorable for small molecule binding

    • Fragment-based screening to identify chemical starting points

  • Therapeutic strategy development:

    • Activation approach: Design molecules that disrupt toxin-antitoxin interaction

    • Inhibition approach: If toxin activation triggers beneficial persistence, develop inhibitors

    • Explore the potential for bactericidal outcomes through toxin activation strategy

  • Resistance development evaluation:

    • Assess frequency of spontaneous resistance

    • Identify potential resistance mechanisms

    • Evaluate fitness cost of resistance mutations

  • Translational considerations:

    • Address the concern that toxin activation might induce persister formation

    • Ensure strategies include approaches for resuscitation of latent cells

    • Evaluate combination approaches with existing antibiotics

The bactericidal nature of Rv1989c makes it particularly attractive as a drug target compared to bacteriostatic toxins, potentially overcoming the persistence issues associated with conventional TA system targeting .

How can researchers address conflicting data when evaluating the therapeutic potential of targeting Rv1989c?

When faced with conflicting data regarding Rv1989c's therapeutic potential, researchers should implement a systematic conflict resolution approach:

  • Evidence quality assessment:

    • Evaluate methodological rigor of conflicting studies

    • Assess sample sizes and statistical power

    • Consider reproducibility across independent laboratories

    • Examine potential sources of bias in experimental design

  • Context-specific effects analysis:

    • Determine if discrepancies arise from different experimental conditions

    • Evaluate strain-specific differences in M. tuberculosis

    • Consider host factors in infection models

    • Assess drug delivery and pharmacokinetic variables

  • Integration of multiple evidence types:

    • Compare in vitro, ex vivo, and in vivo findings

    • Weigh mechanistic studies against phenotypic outcomes

    • Reconcile structural predictions with functional data

    • Apply meta-analytical approaches when appropriate

  • Resolution strategies:

    • Design decisive experiments specifically addressing the conflicting points

    • Implement orthogonal methodologies to validate key findings

    • Consider consortium approaches for standardized evaluation

    • Develop mathematical models that account for variable outcomes

  • Translational decision framework:

    • Establish weighted criteria for advancing targetable aspects

    • Define clear go/no-go decision points

    • Implement stage-gated development processes

    • Maintain flexibility in therapeutic approach based on emerging data

This systematic approach enables researchers to navigate the complexity of contradictory findings while making evidence-based decisions about Rv1989c's therapeutic development .

What methods are most appropriate for characterizing the interaction between Rv1989c and its antitoxin Rv1990c?

Characterizing the Rv1989c-Rv1990c interaction requires a multi-method approach:

  • In vitro binding assays:

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Surface plasmon resonance (SPR) for binding kinetics

    • Microscale thermophoresis (MST) for interaction in solution

    • Analytical ultracentrifugation for complex stoichiometry

  • Structural studies:

    • X-ray crystallography of the complex for atomic-level details

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for dynamic aspects of the interaction

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for binding interfaces

  • Cellular validation:

    • Bacterial two-hybrid assays for in vivo interaction

    • Förster resonance energy transfer (FRET) for proximity assessment

    • Bimolecular fluorescence complementation (BiFC) for complex formation

    • Co-immunoprecipitation to verify complex formation in mycobacteria

  • Interaction mapping:

    • Alanine scanning mutagenesis to identify critical residues

    • Peptide array analysis for binding epitopes

    • Cross-linking coupled with mass spectrometry for interface mapping

    • Truncation analysis to define minimal binding domains

  • Functional consequences:

    • Activity assays with and without antitoxin

    • Competition assays with peptide fragments

    • Cellular toxicity correlations with binding affinity

This comprehensive approach would provide detailed insights into the molecular basis of toxin neutralization by the antitoxin, potentially revealing unique features compared to other TA systems in M. tuberculosis .

How can researchers investigate the oligomerization state of the Rv1989c-Rv1990c complex?

Investigating the oligomerization state of the Rv1989c-Rv1990c complex requires complementary biophysical approaches:

  • Solution-based methods:

    • Size exclusion chromatography (SEC) for approximate molecular weight

    • SEC-MALS (multi-angle light scattering) for absolute molecular mass

    • Analytical ultracentrifugation for sedimentation behavior

    • Dynamic light scattering (DLS) for hydrodynamic radius

    • Native mass spectrometry for complex stoichiometry

  • Structural approaches:

    • X-ray crystallography to reveal packing arrangements

    • Small-angle X-ray scattering (SAXS) for solution conformation

    • Cryo-electron microscopy for quaternary structure

    • Negative stain electron microscopy for complex architecture

  • Cross-linking studies:

    • Chemical cross-linking with mass spectrometry (XL-MS)

    • In vivo cross-linking to capture physiological assemblies

    • Distance measurements from cross-link data

  • Functional implications:

    • Correlation of oligomeric state with activity

    • Mutational disruption of interfaces

    • Comparison with oligomerization patterns of other TA systems (e.g., VapBC complexes form with different binding stoichiometry - 1:1, 1:2, 2:2 or 4:4 antitoxin to toxin ratio)

  • Concentration-dependent behavior:

    • Dilution series to identify dissociation constants

    • Concentration-dependent activity assays

    • Assessment of oligomerization kinetics

This multi-faceted approach would determine whether the Rv1989c-Rv1990c complex forms simple heterodimers or higher-order assemblies that might be critical for regulatory functions or activity control in the M. tuberculosis TA system network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.