Recombinant Uncharacterized protein Rv2077c/MT2137 (Rv2077c, MT2137)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Uncharacterized Protein Rv2077c/MT2137

Recombinant Uncharacterized protein Rv2077c/MT2137, also known as Rv2077c or MT2137, is a protein of Mycobacterium tuberculosis that is not yet fully characterized . Despite the lack of comprehensive understanding of its function, research indicates its involvement in bacterial survival mechanisms and potential interactions with other proteins .

Basic Information

FeatureDescription
NamesUncharacterized protein Rv2077c/MT2137
Gene NamesRv2077c, MT2137
ORF NamesMTCY49.16c
SpeciesMycobacterium tuberculosis
Amino Acid Length323
Molecular WeightApproximately 36 kDa (estimated based on similar proteins)
LocalizationPossible membrane protein

Functional Aspects

While the precise function of Rv2077c/MT2137 remains uncharacterized, studies suggest its involvement in several pathways and biochemical functions :

  • Involved Pathways Rv2077c/MT2137 participates in various pathways, suggesting it has multiple roles within the cell .

  • Biochemical Functions This protein has several biochemical functions that may act alone or in cooperation with other proteins .

  • Interacting Proteins Rv2077c/MT2137 interacts directly with other proteins and molecules, as detected through methods like yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays .

Role in Mycobacterium tuberculosis Survival

Rv2077c/MT2137 is significant for the survival and virulence of Mycobacterium tuberculosis . Mutants with disruptions in the Rv2077c/MT2137 gene exhibit attenuation under hypoxic conditions, indicating its role in the bacterium's adaptation to low-oxygen environments .

Tn insertion mutants of Rv2077c/MT2137 showed reduced CFU counts relative to the isogenic wild-type strain by Day 28 after entry into NRP-2 .

MT#Rv#NameModels AttenuatedFold Attenuation
MT2137Rv2077c-R, Mo HF, GP Aero4.25

R = in vitro progressive hypoxia (reference) model; HF = mouse implantable hollow fiber model; Mo Aero = mouse aerosol model; GP Aero = guinea pig aerosol model .

Co-regulation

Rv2077c is predicted to be co-regulated in modules bicluster_0322 with residual 0.56 and bicluster_0395 with residual 0.54 . This regulation is possibly mediated by two de-novo identified cis-regulatory motifs in each module with e-values , 0.00 and 350.00 for bicluster_0322 and 0.00 and 760.00 for bicluster_0395 respectively .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-323
Protein Length
Full Length of Mature Protein
Target Names
Rv2077c, MT2137
Target Protein Sequence
WNGAGGDGLRQRTRADFSTVSGIADQLRRAATIARNGAGTIDAAQRRVMYAVEDAQDAGF NVGEDLSVTDTKTTQPAAVQAARLAQAQALAGDIRLRVGQLVAAENEVSGQLAATTGDVG NVRFAGAPVVAHSAVQLVDFFKQDGPTPPPPGAPHPSGGADGPYSDPITSMMLPPAGTEA PVSDATKRWVDNMVNELAARPPDDPIAVEARRLAFQALHRPCNSAEWTAAVAGFAGSSAG VVGTALAIPAGPADWALLGAALLGVGGSGAAVVNCATK
Uniprot No.

Q&A

What is Rv2077c/MT2137 and what functional role does it play in Mycobacterium tuberculosis?

Rv2077c (MT2137) is an uncharacterized protein in Mycobacterium tuberculosis that has been identified as a possible membrane protein. Research indicates that Rv2077c plays a significant role in bacterial survival under various stress conditions. According to experimental data, Rv2077c-deficient mutant strains show attenuated growth in multiple experimental models, including reference hypoxia models, mouse hollow fiber models, and guinea pig aerosol models .

The protein is encoded by a 972-nucleotide gene located at position 2333323-2334294 on the negative strand of the MTB genome, producing a protein of 323 amino acids . While its exact function remains to be fully characterized, experimental evidence suggests involvement in stress response pathways that contribute to MTB survival in host environments.

What experimental models have demonstrated the importance of Rv2077c in MTB pathogenesis?

Multiple experimental models have confirmed the role of Rv2077c in MTB pathogenesis, with consistent evidence of attenuation when this gene is disrupted. According to published data, the following models have demonstrated the importance of Rv2077c:

Model TypeAttenuation ObservedFold Attenuation
In vitro progressive hypoxia (reference) modelYes4.25
Mouse hollow fiber modelYesSignificant
Guinea pig aerosol modelYesSignificant

This pattern of attenuation across different model systems suggests that Rv2077c participates in adaptation mechanisms crucial for MTB survival in diverse host environments . The consistent attenuation in both in vitro and in vivo models indicates that this protein may be important in multiple stages of infection.

What are the optimal conditions for expressing recombinant Rv2077c protein?

When designing expression systems for recombinant Rv2077c, several parameters must be optimized:

  • Expression System Selection: E. coli has been successfully used for recombinant expression of mycobacterial membrane proteins, including Rv2077c. For more complex studies requiring eukaryotic post-translational modifications, consider insect cell systems like Sf9 .

  • Critical Parameters for Optimization:

    • Cell count at infection (CCI): Optimal range is 5-6 × 10^6 cells/ml

    • Multiplicity of infection (MOI): 1.5-2.0 typically yields good results

    • Temperature: Lower temperatures (23-25°C) often improve membrane protein folding

    • Additives: Consider adding membrane stabilizers like pluronic F-68 (0.3-0.4%)

  • Induction Conditions: For E. coli systems, IPTG concentration and induction temperature significantly impact protein folding. Lower temperatures (16-18°C) with extended expression times often improve membrane protein solubility.

  • Purification Strategy: Include detergents appropriate for membrane proteins (e.g., n-dodecyl β-D-maltoside) during cell lysis and purification steps. His-tagged constructs of Rv2077c have been successfully purified using immobilized metal affinity chromatography .

Application of experimental design methodology (DOE) with response surface methodology can significantly improve recombinant protein yields, as demonstrated with other complex proteins .

How should researchers design experiments to study the function of Rv2077c in MTB pathogenesis?

When designing experiments to study Rv2077c function in pathogenesis, a systematic approach is essential:

  • Study Design Framework:

    • Begin with clear research questions focusing on specific aspects of Rv2077c function

    • Use a multi-model approach to validate findings across different experimental systems

    • Implement both gain-of-function and loss-of-function studies

  • Recommended Experimental Design Approach:

    • Start with gene knockout or transposon mutant strains (ΔRv2077c)

    • Include complemented strains (ΔRv2077c:comp) to confirm phenotype restoration

    • Consider overexpression strains (Rv2077c:OE) to assess gain-of-function effects

    • Always include appropriate wildtype controls

  • Model Systems Selection:

    • In vitro: Progressive hypoxia models to assess role in dormancy/persistence

    • Ex vivo: Macrophage infection models to assess intracellular survival

    • In vivo: Mouse and guinea pig models for whole-organism pathogenesis studies

  • Control Considerations:

    • Include technical and biological replicates (minimum n=3, but larger sample sizes improve statistical power)

    • Control for confounding variables by randomization and blocking designs

    • For in vivo studies, consider randomized block designs grouped by factors like age or weight

  • Data Analysis Plan:

    • Pre-determine statistical approaches and sample sizes needed for adequate power

    • Consider both parametric and non-parametric tests depending on data distribution

    • Plan for multiple testing corrections when assessing multiple outcomes

What methodologies are most effective for characterizing protein-protein interactions involving Rv2077c?

Characterizing protein-protein interactions for membrane proteins like Rv2077c requires specialized approaches:

  • In Vitro Interaction Assays:

    • Pull-down assays: Using recombinant His-tagged Rv2077c as bait to identify binding partners from mycobacterial lysates or host cell extracts

    • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics with purified interaction partners

    • Isothermal Titration Calorimetry (ITC): To determine thermodynamic parameters of interactions

  • Cellular Interaction Systems:

    • Bacterial Two-Hybrid (B2H): Particularly useful for membrane proteins when traditional Y2H may fail

    • Split-GFP Complementation: Allows visualization of interactions in living cells

    • Co-immunoprecipitation (Co-IP): Using specific antibodies against Rv2077c to pull down protein complexes from mycobacterial lysates

  • Advanced Structural Approaches:

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map interaction interfaces

    • Crosslinking Mass Spectrometry (XL-MS): For capturing transient interactions

    • Cryo-Electron Microscopy: For structural characterization of membrane protein complexes

  • Computational Prediction:

    • Molecular dynamics simulations to predict protein-protein interfaces

    • Machine learning approaches for interaction partner prediction based on homology

When designing these experiments, researchers should include appropriate controls, such as known interaction partners or non-interacting proteins, to validate the specificity of observed interactions.

How does Rv2077c contribute to MTB survival under hypoxic conditions, and what are the molecular mechanisms involved?

Research indicates that Rv2077c plays a significant role in MTB adaptation to hypoxia, a key stress condition encountered during infection:

  • Evidence from Hypoxia Models:

    • Transposon mutants of Rv2077c show significant attenuation (4.25-fold) in progressive hypoxia models

    • This suggests Rv2077c is crucial for adapting to low-oxygen environments, which mimics conditions in granulomas

  • Potential Molecular Mechanisms:

    • As a putative membrane protein, Rv2077c may be involved in:

      • Maintaining membrane integrity under hypoxic stress

      • Modulating redox balance across the cell membrane

      • Facilitating nutrient acquisition under stress conditions

      • Signal transduction for hypoxia-responsive gene regulation

  • Relationship to Known Hypoxia Response Pathways:

    • Rv2077c is likely part of the DosR/DevR regulon, which controls approximately 50 genes induced under hypoxic conditions

    • Its function may complement other hypoxia-responsive proteins like HspX (Rv2031c), which also shows attenuation in hypoxia models (8.30-fold)

  • Experimental Approaches to Elucidate Mechanisms:

    • Transcriptomic analysis of ΔRv2077c mutants under hypoxia to identify dysregulated pathways

    • Metabolomic profiling to identify altered metabolic pathways

    • Membrane potential measurements to assess membrane function

    • Redox state analysis using fluorescent probes

Understanding the precise molecular mechanisms of Rv2077c function in hypoxia adaptation would provide insights into MTB persistence and potentially identify new drug targets for latent TB infection.

What is the optimal strategy for generating and validating Rv2077c knockout mutants in MTB?

Creating and validating Rv2077c knockout mutants requires careful methodology to ensure specificity and completeness of gene disruption:

  • Knockout Strategy Options:

    • Homologous Recombination: Traditional approach using suicide vectors containing antibiotic resistance markers flanked by Rv2077c homologous regions

    • Specialized Transduction: Phage-based delivery of allelic exchange substrates (more efficient than plasmid-based methods)

    • CRISPR-Cas9: Emerging technique for mycobacteria allowing precise genomic editing

  • Detailed Protocol Framework:

    • Design constructs with at least 500-800 bp homology arms flanking Rv2077c

    • Include selectable markers (hygromycin or kanamycin resistance)

    • Consider unmarked deletion strategies using γδ-resolvase or Cre-loxP for multiple genetic manipulations

    • Perform electroporation into MTB using optimized parameters for highest efficiency

  • Comprehensive Validation Strategy:

    • Genomic confirmation:

      • PCR verification using primers outside the recombination region

      • Southern blot analysis to confirm single integration at the correct locus

    • Transcriptional confirmation:

      • RT-PCR to verify absence of Rv2077c transcript

      • RNA-Seq to assess potential polar effects on adjacent genes

    • Protein confirmation:

      • Western blot using anti-Rv2077c antibodies

      • Proteomics approaches to confirm absence of protein

  • Complementation Controls:

    • Create complementation constructs using integrative vectors (e.g., pMV306)

    • Use the native promoter region (approximately 500 bp upstream) for physiological expression levels

    • Include epitope tags for detection if antibodies aren't available

    • Verify complementation by restoration of wild-type phenotypes in key assays

This comprehensive knockout and validation strategy ensures that observed phenotypes can be confidently attributed to the absence of Rv2077c rather than polar effects or secondary mutations .

What are the most effective assays for measuring the impact of Rv2077c on MTB survival in experimental models?

To comprehensively assess the impact of Rv2077c on MTB survival, researchers should employ multiple complementary assays:

  • In Vitro Survival Assays:

    • Hypoxia Adaptation: Wayne model or microfluidic devices with oxygen sensors

    • Nutrient Starvation: PBS starvation model with CFU enumeration at defined timepoints

    • Acid Stress Survival: Exposure to acidified media (pH 4.5-5.5) mimicking phagosomal conditions

    • Oxidative/Nitrosative Stress: H₂O₂ or NO donor exposure with survival quantification

  • Cellular Infection Models:

    • Macrophage Survival Assay: Infection of primary macrophages or cell lines with CFU enumeration

    • Intracellular Trafficking Analysis: Fluorescence microscopy to track phagosomal maturation

    • Cell Death Modulation: Measure apoptosis vs. necrosis in infected macrophages using flow cytometry

    • Cytokine Response: Quantify pro/anti-inflammatory cytokine production using ELISA or multiplex assays

  • Animal Model Approaches:

    • Mouse Aerosol Model: Low-dose infection with CFU determination in lungs and spleen

    • Mouse Hollow Fiber Model: Implantable chambers allowing bacterial replication in vivo while preventing dissemination

    • Guinea Pig Model: More representative of human granulomas, with CFU and histopathology analysis

  • High-Throughput Screening Approaches:

    • Transposon Sequencing (TnSeq): Compare fitness of Rv2077c mutants across multiple conditions

    • Designer Arrays for Defined Mutant Analysis (DeADMAn): Microarray-based approach to monitor mutant survival

  • Key Metrics for Quantification:

    • Colony-forming units (CFU): For bacterial survival measurement

    • Relative competitive index (RCI): For mixed-infection competition assays

    • Bacterial burden in tissues: By CFU or quantitative PCR

    • Histopathological scoring of lesions: For in vivo virulence assessment

When implementing these assays, rigorous controls and sufficient biological replicates are essential. For in vivo studies, power analysis should be conducted to determine appropriate sample sizes, and experiments should be designed to minimize animal usage while maintaining statistical validity .

How can researchers effectively utilize response surface methodology (RSM) for optimizing Rv2077c protein expression?

Response Surface Methodology (RSM) provides a powerful approach for optimizing recombinant protein expression by efficiently exploring multiple variables simultaneously:

  • Initial Parameter Screening:

    • Begin with Plackett-Burman design to identify significant variables affecting Rv2077c expression

    • Test 6-8 potential factors including temperature, inducer concentration, media composition, cell density, and additives

    • Use protein yield and solubility as response variables

  • RSM Implementation Strategy:

    • Apply Box-Behnken design for the 3-4 most influential parameters identified in screening

    • Design experiments with three levels (low, medium, high) for each parameter

    • Include center points for estimating experimental error

    • For Rv2077c as a membrane protein, focus on:

      • Induction temperature (18-30°C)

      • Inducer concentration

      • Cell density at induction

      • Membrane-stabilizing additives (e.g., glycerol, cholesterol)

  • Detailed Experimental Design Framework:

    ParameterLow LevelMiddle LevelHigh Level
    Temperature18°C23°C28°C
    IPTG concentration0.1 mM0.5 mM1.0 mM
    Cell density (OD₆₀₀)0.61.01.4
    Membrane stabilizer0%0.2%0.4%
  • Analysis and Model Development:

    • Fit experimental data to second-order polynomial equations

    • Generate response surface plots to visualize parameter interactions

    • Identify optimal conditions through mathematical optimization

    • Validate predicted optimum with confirmation experiments

  • Scale-up Considerations:

    • Verify optimized conditions in larger culture volumes

    • Monitor key parameters during scale-up (oxygen transfer, mixing, etc.)

    • Adjust parameters if necessary based on scale-dependent effects

This systematic approach has shown success with complex proteins, improving expression by 3-4 fold compared to standard conditions . For membrane proteins like Rv2077c, RSM is particularly valuable as they often require specific conditions for proper folding and membrane insertion.

How can Rv2077c research contribute to tuberculosis drug discovery and development?

Rv2077c research can significantly impact TB drug discovery through multiple approaches:

  • Target Validation Considerations:

    • Rv2077c has been demonstrated as essential for MTB survival in multiple models

    • Its attenuation in guinea pig models (a gold standard for TB drug testing) suggests clinical relevance

    • As a membrane protein potentially involved in stress response, it represents a novel target class

  • Drug Discovery Approaches:

    • Target-based screening: Using purified recombinant Rv2077c to screen for direct inhibitors

    • Phenotypic screening: Testing compounds against wildtype vs. Rv2077c-overexpressing strains

    • Fragment-based drug discovery: Identifying small molecule binders that can be developed into leads

    • Structure-based design: Once structural data is available, rational design of inhibitors

  • Assay Development Strategies:

    • Develop functional assays reflecting the protein's role in stress response

    • Create reporter systems linking Rv2077c function to measurable outputs

    • Design cell-based assays measuring Rv2077c-dependent phenotypes

  • Translational Research Applications:

    • Combination therapy assessment: Test Rv2077c inhibitors with existing TB drugs

    • Resistance studies: Characterize potential resistance mechanisms

    • Animal model validation: Test candidates in hollow fiber and aerosol infection models

  • Special Considerations for Membrane Protein Targets:

    • Focus on inhibiting external domains more accessible to drugs

    • Consider lipophilicity requirements for compounds targeting transmembrane regions

    • Develop assays compatible with membrane protein biochemistry

By targeting Rv2077c, researchers may discover compounds effective against both active and latent TB infections due to its role in hypoxia adaptation, potentially addressing a major challenge in TB treatment .

What are the most significant contradictions or knowledge gaps in the current understanding of Rv2077c function?

Despite progress in identifying Rv2077c as important for MTB survival, several critical knowledge gaps and contradictions remain:

  • Functional Characterization Contradictions:

    • While classified as a "possible membrane protein," definitive evidence for membrane localization and topology is lacking

    • The protein's biochemical function remains unknown—whether it acts as a transporter, signaling protein, or structural component

    • The discrepancy between its importance in various models and lack of functional characterization represents a major gap

  • Regulatory Network Uncertainties:

    • It remains unclear whether Rv2077c is regulated by known stress-response systems like DosR/DevR

    • Transcriptomic studies show variable results regarding its induction under stress conditions

    • The regulatory elements controlling Rv2077c expression are not well characterized

  • Interaction Partner Contradictions:

    • Preliminary studies suggest potential protein-protein interactions, but these have not been independently validated

    • The relationship between Rv2077c and other membrane proteins involved in stress response remains poorly understood

  • Host-Pathogen Interface Questions:

    • Whether Rv2077c directly interacts with host factors or simply supports bacterial survival is unknown

    • If it does interact with host components, the nature and consequences of these interactions are uncharacterized

  • Methodology Challenges Contributing to Knowledge Gaps:

    • Technical difficulties in working with membrane proteins have limited structural and biochemical studies

    • Variability in experimental models makes cross-study comparisons challenging

    • Limited antibody availability restricts detection approaches

Addressing these knowledge gaps requires integrated approaches combining genetic, biochemical, and structural studies. Particular emphasis should be placed on defining the protein's membrane topology, identifying interaction partners, and establishing its role in regulatory networks controlling stress responses .

How can researchers effectively design experiments to distinguish between direct and indirect effects of Rv2077c on MTB pathogenesis?

Distinguishing direct from indirect effects of Rv2077c on pathogenesis requires sophisticated experimental designs:

  • Temporal Analysis Approaches:

    • Implement time-course experiments using inducible expression systems

    • Analyze immediate vs. delayed responses after Rv2077c expression/repression

    • Early response genes/processes (0-6 hours) are more likely to represent direct effects

  • Molecular Interaction Studies:

    • Use techniques like ChIP-seq (for DNA interactions) or CLIP-seq (for RNA interactions) to identify direct binding targets

    • Implement proximity labeling approaches (BioID, APEX) to identify proteins in close physical association with Rv2077c

    • Validate interactions using in vitro binding assays with purified components

  • Genetic Approach Framework:

    • Create point mutations in functional domains to disrupt specific activities while maintaining protein expression

    • Implement synthetic genetic array analysis to identify genetic interactions

    • Use epistasis analysis with double mutants to establish pathway relationships

  • Biochemical Function Determination:

    • Purify recombinant protein for in vitro activity assays

    • Test enzymatic functions based on bioinformatic predictions

    • Analyze post-translational modifications that may regulate activity

  • Systems Biology Integration:

    • Combine transcriptomics, proteomics, and metabolomics to build causal networks

    • Apply mathematical modeling to distinguish direct effects from downstream consequences

    • Implement Bayesian network analysis to infer causal relationships

  • Experimental Controls and Validation:

    • Include appropriate time-matched controls for all experiments

    • Use complementary approaches to validate findings

    • Implement dose-response studies to establish causality

By systematically applying these approaches, researchers can build a comprehensive model distinguishing primary functions of Rv2077c from secondary effects, enabling more accurate understanding of its role in pathogenesis and potentially revealing new intervention strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.