| Parameter | Specification |
|---|---|
| Purity | >90% (SDS-PAGE) |
| Storage Buffer | Tris/PBS-based, 6% Trehalose, pH 8.0 |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL) with 50% glycerol recommended |
Short-term: 1 week at 4°C (working aliquots)
Long-term: 6–12 months at -20°C/-80°C (lyophilized or liquid)
Antigen characterization for tuberculosis vaccine development (inferred from homology)
Protein-protein interaction screens (no confirmed partners reported)
Solubility: Requires detergents or lipid systems for stabilization due to transmembrane nature
Expression Optimization: Strains like E. coli C41/C43(DE3) or Lemo21(DE3) recommended to mitigate toxicity
Recombinant Uncharacterized protein Rv2081c/MT2143 is a 146-amino acid protein from Mycobacterium tuberculosis that has not yet been functionally characterized. The protein is typically expressed in E. coli systems with an N-terminal His-tag for purification purposes. According to available data, the protein has the following properties:
| Property | Description |
|---|---|
| Source organism | Mycobacterium tuberculosis |
| Full length | 146 amino acids |
| Expression system | E. coli |
| Tag | N-terminal His-tag |
| Form | Lyophilized powder |
| Storage buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Amino acid sequence | MFANAGLSPFVAIWTARAASLYTSHNFWCAAAVSAAVYVGSAVVPAAVAGPLFVGRVSAT IKAAAPSTTAAIATLATAANGQLRERGGAGGWVGVHCPVVGGGGVGHPRKAIAAAVSVHS TCMPAAFGGHLGLGDRSRSVSLSGTP |
For optimal storage, the protein should be stored at -20°C/-80°C upon receipt, with aliquoting recommended for multiple use to avoid repeated freeze-thaw cycles .
Rv2081c/MT2143 is one of several uncharacterized proteins in the M. tuberculosis genome. Comparative analysis with other uncharacterized proteins reveals:
Sequence comparison: Unlike characterized proteins such as Rv2118c (a single-component homotetrameric m1A58 tRNA methyltransferase) or Rv2145c (involved in intracellular survival) , Rv2081c lacks clearly identified functional domains.
Expression patterns: Similar to proteins like Rv0010c and Rv0011c, Rv2081c appears to be constitutively expressed in M. tuberculosis rather than specifically upregulated during infection .
Conservation: Rv2081c/MT2143 shows conservation across mycobacterial species, suggesting a potentially important role in mycobacterial physiology. This pattern of conservation is similar to that observed in other membrane-associated proteins like Rv0010c .
Initial bioinformatic characterization should include:
Sequence homology analysis: Utilize BLAST, Pfam, and SMART databases to identify conserved domains and homologous proteins.
Secondary structure prediction: Apply algorithms such as PSIPRED, JPred, and GOR IV to predict alpha helices, beta sheets, and random coils.
Tertiary structure modeling: Employ I-TASSER, Phyre2, and AlphaFold2 to generate 3D structural models.
Functional prediction: Use tools like InterProScan, ProtFun, and COFACTOR to predict potential functions.
Subcellular localization prediction: Apply SignalP, TMHMM, and PSORTb to predict cellular localization.
Comprehensive bioinformatic analysis will provide preliminary insights into Rv2081c/MT2143's potential functions, which can guide subsequent experimental designs and hypothesis formulation.
A factorial design of experiments (DOE) approach is most effective for optimizing recombinant Rv2081c/MT2143 expression. This systematic method allows researchers to evaluate multiple parameters simultaneously and identify optimal conditions .
The recommended experimental design includes:
Initial screening via Plackett-Burman design: Screen 6-12 variables that may affect expression:
Induction temperature (18-37°C)
IPTG concentration (0.1-1.0 mM)
Cell density at induction (OD600 0.4-1.0)
Post-induction time (4-24 hours)
Media composition (LB, TB, 2xYT)
Feed percentage (if using fed-batch)
Additives (glycerol, sucrose, amino acids)
Optimization via Box-Behnken approach: After identifying significant variables, optimize using 3-level design:
| Parameter | Low (-1) | Middle (0) | High (+1) |
|---|---|---|---|
| Temperature | 18°C | 25°C | 30°C |
| IPTG | 0.1 mM | 0.5 mM | 1.0 mM |
| Cell density | OD 0.4 | OD 0.6 | OD 0.8 |
Response measurement: Evaluate protein yield and solubility through SDS-PAGE, Western blot, and activity assays.
Statistical analysis: Use response surface methodology to identify optimal conditions and potential interactions between variables .
This approach has demonstrated effectiveness in optimizing expression of mycobacterial proteins, with studies showing up to 3.6-fold increases in expression levels compared to non-optimized conditions .
To improve Rv2081c/MT2143 solubility, consider these methodological approaches:
Host strain selection:
Vector modifications:
Fusion partners: Thioredoxin, SUMO, MBP, or GST tags
Codon optimization for E. coli expression
Inclusion of solubility-enhancing sequences
Culture conditions optimization:
Reduced incubation temperature (16-25°C)
Additives: 5-10% glycerol, 0.1-1.0% glucose, 1-5 mM betaine
Osmotic shock treatment
Supplementation with 0.2-0.5% Triton X-100 for membrane proteins
Co-expression strategies:
Molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)
Rare tRNA-encoding plasmids
Mycobacterial-specific factors
Buffer optimization for purification:
Tris-NaCl buffer (100 mM NaCl, 20 mM Tris-HCl, pH 8.0)
Addition of 10% glycerol for stability
Low concentrations of non-ionic detergents if membrane-associated
Implementing these modifications systematically using a design of experiments approach can significantly improve soluble protein yield, as demonstrated for other challenging mycobacterial proteins .
An effective purification strategy for Rv2081c/MT2143 involves multiple chromatographic steps:
Initial capture via Ni-NTA affinity chromatography:
Equilibration buffer: 20 mM Tris-HCl, 100 mM NaCl, pH 8.0
Wash buffer: Equilibration buffer + 20-40 mM imidazole
Elution buffer: Equilibration buffer + 250-500 mM imidazole
Flow rate: 1 ml/min for optimal binding
Intermediate purification via ion exchange chromatography:
Calculate theoretical pI from sequence to determine appropriate resin
For Rv2081c/MT2143: Use anion exchange (Q-Sepharose) at pH 8.5
Buffer: 20 mM Tris-HCl, pH 8.5
Elution: Linear gradient of 0-500 mM NaCl
Polishing via size exclusion chromatography:
Column: Superdex 75 or Superdex 200
Buffer: 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Flow rate: 0.5 ml/min for optimal resolution
Quality control assessments:
This multi-step approach typically yields protein with >90% purity as determined by SDS-PAGE, suitable for structural and functional studies .
To determine the potential role of Rv2081c/MT2143 in pathogenesis, employ these methodological approaches:
Gene knockout and complementation studies:
Create a clean deletion mutant of Rv2081c in M. tuberculosis
Develop complemented strains with wildtype Rv2081c
Compare growth kinetics in standard media and stress conditions
Assess survival in macrophage infection models
Measure virulence in animal models (e.g., mouse infection)
Heterologous expression in non-pathogenic mycobacteria:
Host-pathogen interaction studies:
Expose macrophages to purified Rv2081c protein
Measure cytokine production (TNF-α, IL-10, IL-6, IL-12)
Assess activation of pattern recognition receptors (TLRs)
Analyze effects on phagosome maturation
Evaluate impact on macrophage polarization (M1/M2)
Transcriptomic and proteomic analysis:
Compare gene expression profiles of wildtype vs. Rv2081c-deleted strains
Identify differentially regulated genes and pathways
Perform proteomics to assess changes in protein abundance
Analyze secretome alterations
These approaches have successfully elucidated the roles of other M. tuberculosis proteins like Rv2145c and Rv2231c in pathogenesis .
Characterizing interactions between Rv2081c/MT2143 and host immune receptors requires a comprehensive approach:
Receptor identification:
Screen purified Rv2081c using TLR reporter cell lines (HEK-Blue™)
Perform co-immunoprecipitation with macrophage lysates
Use surface plasmon resonance (SPR) to test direct binding with recombinant receptors
Apply CRISPR-Cas9 receptor knockout in macrophages to confirm specificity
Signaling pathway analysis:
Examine MAPK, NF-κB, and STAT pathway activation via Western blotting
Monitor TLR-dependent gene expression using qRT-PCR
Assess receptor complex formation using proximity ligation assays
Measure calcium flux and reactive oxygen species production
Functional consequences assessment:
Cytokine profiling via ELISA and multiplex assays
Flow cytometry analysis of surface markers (CD80, CD86, MHC-I/II)
Evaluate macrophage polarization markers
Measure bacterial survival in receptor-deficient cells
Structural mapping of interaction domains:
Generate truncated protein variants to identify binding regions
Perform site-directed mutagenesis of predicted interaction sites
Use hydrogen-deuterium exchange mass spectrometry to map binding interfaces
Develop computational models of protein-receptor complexes
This methodological framework has successfully identified TLR4 as a receptor for other M. tuberculosis proteins like Rv2231c, which modulates host immune responses to promote bacterial survival .
To assess potential enzymatic activities of Rv2081c/MT2143, implement this systematic screening approach:
Sequence-based activity prediction:
Search for catalytic motifs and domains using specialized databases
Compare with structurally characterized enzymes
Identify conserved catalytic residues across homologs
High-throughput activity screening:
Design colorimetric assays for common enzymatic activities:
Hydrolase activity (esterase, protease, glycosidase)
Transferase activity (methyltransferase, kinase)
Oxidoreductase activity (dehydrogenase, oxidase)
Screen against substrate libraries in 96-well format
Monitor changes in pH, cofactor redox state, or substrate disappearance
Metabolite analysis:
Incubate protein with mycobacterial lysates
Perform untargeted metabolomics to identify altered compounds
Use stable isotope labeling to track substrate conversion
Compare metabolite profiles between wildtype and knockout strains
Structural analysis for activity prediction:
Identify potential active site pockets using computational tools
Dock potential substrates in silico
Perform molecular dynamics simulations with cofactors
Compare binding energies with known substrates of related enzymes
Targeted activity assays based on predictions:
Design specific assays for the most likely activities
Include appropriate positive and negative controls
Test dependency on common cofactors (ATP, NAD(P)H, AdoMet)
Determine optimal pH, temperature, and metal ion requirements
Similar approaches successfully identified the tRNA methyltransferase activity of Rv2118c from M. tuberculosis, which was initially uncharacterized .
To investigate Rv2081c/MT2143's role in persistence and dormancy, implement these methodological approaches:
Expression analysis under dormancy-inducing conditions:
Monitor Rv2081c expression in the Wayne hypoxia model
Compare expression levels in nutrient starvation models
Examine regulation under nitric oxide stress
Measure protein levels during macrophage infection using reporter strains
Genetic manipulation studies:
Create conditional knockdown strains of Rv2081c
Evaluate survival of knockdown strains under dormancy conditions
Perform complementation with wild-type and mutant variants
Analyze transcriptional changes in dormancy regulon genes
Dormancy phenotype characterization:
Assess lipid body formation using Nile Red staining
Measure antibiotic tolerance profiles
Evaluate respiratory activity using resazurin reduction
Determine ATP levels during entrance/exit from dormancy
In vivo persistence models:
Compare wild-type and Rv2081c-deficient strains in Cornell model of latent TB
Analyze bacterial loads in chronic mouse infection models
Assess reactivation potential following immunosuppression
Perform histopathological analysis of granulomas
Integration with systems biology data:
Compare Rv2081c expression with known dormancy regulators (DosR regulon)
Perform network analysis to identify potential functional partners
Integrate transcriptomics, proteomics, and metabolomics data
Develop predictive models of Rv2081c's role in persistence
This comprehensive approach has elucidated roles of other initially uncharacterized proteins in M. tuberculosis dormancy and could reveal whether Rv2081c is involved in this critical aspect of tuberculosis pathogenesis .
To evaluate Rv2081c/MT2143 as a potential drug target, implement this systematic approach:
Target validation:
Determine essentiality using conditional knockdown or CRISPRi systems
Evaluate growth patterns in different media and stress conditions
Assess impact on virulence in cellular and animal infection models
Compare conservation across mycobacterial species and absence in humans
Structural characterization for druggability assessment:
Obtain high-resolution crystal or cryo-EM structure
Identify potential binding pockets using computational tools (SiteMap, FTMap)
Assess druggability indices of identified pockets
Compare with known successful drug target structures
High-throughput screening (HTS) assay development:
Design activity-based assays with Z' factor >0.5
Develop binding assays using thermal shift or surface plasmon resonance
Establish counter-screening assays to eliminate false positives
Validate with known inhibitors of similar protein classes if available
In silico drug discovery approaches:
Perform virtual screening against compound libraries
Conduct fragment-based screening for initial hits
Design structure-based pharmacophore models
Use molecular dynamics simulations to identify transient binding sites
Hit validation and optimization:
Confirm binding using orthogonal biophysical methods
Determine structure-activity relationships
Assess selectivity against human homologs
Evaluate cellular activity against M. tuberculosis
Measure cytotoxicity against mammalian cell lines
This approach has successfully identified drug candidates targeting mycobacterial proteins, including initially uncharacterized ones, and could establish whether Rv2081c represents a viable target for anti-tuberculosis drug development .
To investigate the immunomodulatory potential of Rv2081c/MT2143, design experiments following these methodological guidelines:
Innate immune response characterization:
Stimulate macrophages, dendritic cells, and neutrophils with purified protein
Measure cytokine production (TNF-α, IL-6, IL-12, IL-10, IL-1β) via ELISA
Assess pattern recognition receptor activation using reporter cell lines
Evaluate ROS/RNS production using fluorescent probes
Analyze phagocytosis efficiency and phagosome maturation
Adaptive immunity investigation:
Perform T-cell epitope mapping using overlapping peptides
Assess antigen presentation via MHC-I and MHC-II pathways
Measure T-cell proliferation in response to Rv2081c stimulation
Determine T-helper polarization (Th1/Th2/Th17/Treg) profiles
Evaluate memory T-cell generation in recall response assays
Systems immunology approach:
Conduct transcriptomic analysis of stimulated immune cells
Perform phosphoproteomic analysis of signaling pathways
Apply single-cell RNA sequencing to identify responding cell populations
Develop computational models of immune response networks
In vivo immunological studies:
Evaluate adjuvant properties in vaccination models
Assess protection against challenge in animal models
Analyze granuloma formation and composition
Measure antibody responses and determine isotype profiles
Clinical correlation studies:
Compare immune responses in different TB patient cohorts
Analyze Rv2081c-specific responses in latent vs. active TB
Investigate potential as diagnostic or prognostic biomarker
This experimental framework has successfully characterized immunomodulatory properties of M. tuberculosis proteins such as Rv2145c, which was found to promote M2 macrophage polarization and inhibit pro-inflammatory cytokine production .
For analyzing protein-protein interaction (PPI) data involving Rv2081c/MT2143, implement these statistical approaches:
Pull-down and co-immunoprecipitation data analysis:
Apply Student's t-test or ANOVA for comparing band intensities
Use fold-enrichment calculations (target protein/control) with appropriate normalization
Implement Bayesian statistics to estimate probability of true interactions
Set stringent cutoffs (typically >2-fold enrichment, p<0.05)
Yeast two-hybrid screening analysis:
Apply hypergeometric distribution to assess enrichment of functional categories
Use permutation tests to determine significance of interaction networks
Implement multiple testing correction (Benjamini-Hochberg or Bonferroni)
Calculate confidence scores based on reporter strength and reproducibility
Mass spectrometry-based interactomics:
Use significance analysis of interactome (SAINT) algorithm
Apply CompPASS scoring for comparative proteomics
Implement MaxQuant and Perseus for label-free quantification
Set false discovery rate thresholds (typically 1% FDR)
Use volcano plots to visualize significant interaction partners
Network analysis:
Calculate centrality measures (degree, betweenness, closeness)
Identify significantly enriched network modules using MCODE or MCL
Perform Gene Ontology enrichment analysis of interaction partners
Use random network models as controls for network property comparison
Implement Cytoscape for visualization and topological analysis
Integration with orthogonal datasets:
Apply Bayesian data integration methods
Use correlation analysis with transcriptomic profiles
Implement machine learning for prediction of functional associations
Calculate weighted integration scores across multiple experimental platforms
These statistical approaches have successfully identified functional interactions for other initially uncharacterized mycobacterial proteins, revealing their roles in specific biological pathways .
When facing contradictory results in Rv2081c/MT2143 functional studies, implement this systematic troubleshooting approach:
Methodological reconciliation:
Compare experimental conditions in detail (protein preparation, buffer composition, cell types)
Assess protein quality (purity, tag interference, proper folding, aggregation state)
Examine expression systems used (E. coli vs. mycobacterial hosts)
Evaluate assay sensitivity and specificity across different studies
Statistical reassessment:
Recalculate statistical power to detect meaningful differences
Compare effect sizes rather than just p-values
Implement meta-analysis techniques if multiple datasets exist
Consider Bayesian approaches to integrate contradictory evidence
Biological context evaluation:
Investigate strain-specific differences in Rv2081c sequence or regulation
Consider cell type-specific effects and microenvironmental factors
Assess post-translational modifications that may alter function
Examine potential moonlighting functions in different contexts
Experimental validation strategy:
Design decisive experiments with appropriate positive and negative controls
Use orthogonal methods to test the same hypothesis
Implement dose-response studies rather than single concentrations
Develop targeted genetic approaches (point mutations of key residues)
Conduct time-course experiments to capture dynamic effects
Collaborative resolution approach:
Initiate direct collaboration with laboratories reporting contradictory results
Exchange reagents, protocols, and samples for direct comparison
Perform blinded analyses to minimize bias
Consider joint publication of reconciliation efforts
This framework has successfully resolved contradictory findings regarding other M. tuberculosis proteins, such as those initially thought to have opposing effects on host immune responses .
For comprehensive structural prediction of Rv2081c/MT2143, implement this multi-layered bioinformatic approach:
This comprehensive approach has enabled successful structural characterization of other initially uncharacterized mycobacterial proteins, providing insights into their potential functions and interaction capabilities .