Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Target Names
Rv2091c, MT2152
Target Protein Sequence
MSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYTPQYQQPADPA YPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQYGQPGQYGQPGQYAPPGQYPG QYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGAVLILGFWAPGFFVTTKLDVIKAQAGVQ QVLTDETTGYGAKNVKDVKCNNGSDPTVKKGATFECTVSIDGTSKRVTVTFQDNKGTYEV GRPQ
Uniprot No.

Q&A

What structural information is available for Rv2091c/MT2152?

The SWISS-MODEL Repository provides structural data for Rv2091c/MT2152 (UniProt ID: P9WLJ5). One structural model has been generated based on template 2qgu.1.A, suggesting a monomeric configuration with the following characteristics:

TemplateOligo-stateQMEANRangeLigandsTrg-Tpl Seq id (%)
2qgu.1.Amonomer0.5113.33--

The QMEAN score of 0.51 indicates moderate reliability of the model . The protein appears to contain regions consistent with transmembrane domains, supporting its classification as a probable membrane protein. This structural information, while valuable, remains limited compared to experimental determination methods such as X-ray crystallography or cryo-EM.

How does Rv2091c expression change in response to antimicrobial agents?

Microarray analysis has revealed that Rv2091c shows differential expression when M. tuberculosis is exposed to certain antimicrobial compounds. The table below summarizes these findings:

GeneRv no.INHISOTHL2219679190Putative function
Rv2091cRv2091c3-23-4Unknown, probable membrane protein

The numbers in columns (INH: isoniazid, ISO: isoxyl, THL: tetrahydrolipstatin, SRI# 221/967/9190) indicate the number of statistical tests in which the gene was found to be significantly induced (minimum of 2, maximum 4) . This upregulation pattern suggests that Rv2091c may play a role in the bacterium's response to these antimicrobial stressors, potentially contributing to adaptation or resistance mechanisms.

Where is Rv2091c/MT2152 located within the bacterial cell?

Based on bioinformatic predictions and functional annotations, Rv2091c/MT2152 is classified as a "probable membrane protein" . Its amino acid sequence contains hydrophobic regions consistent with transmembrane domains, particularly in the central portion of the protein. While experimental verification of its subcellular localization is still needed, the current evidence suggests it is an integral membrane protein. This localization may indicate roles in processes such as membrane integrity maintenance, transport, or signal transduction across the mycobacterial cell envelope.

How should I design experiments to characterize the function of Rv2091c/MT2152?

A systematic experimental design approach for characterizing Rv2091c involves multiple stages:

  • Comparative Genomics Analysis:

    • Perform phylogenetic analysis across mycobacterial species to identify conserved domains

    • Examine synteny of the genomic region containing Rv2091c for functional associations

    • Use sensitive homology detection methods (PSI-BLAST, HHpred) to identify distant relationships

  • Expression Profiling:

    • Quantify expression under conditions where it shows differential regulation (antimicrobial stress)

    • Conduct transcriptomic analysis across infection stages in cellular and animal models

    • Implement ribosome profiling to confirm translation efficiency

  • Genetic Manipulation:

    • Generate unmarked deletion mutants using specialized mycobacterial recombineering systems

    • Create conditional knockdown strains using tetracycline-inducible systems

    • Develop complementation strains with tagged versions for localization studies

  • Biochemical Characterization:

    • Express recombinant protein with appropriate solubilization tags (MBP, SUMO)

    • Perform membrane topology mapping using cysteine accessibility methods

    • Conduct pull-down assays to identify interaction partners

  • Phenotypic Analysis:

    • Assess growth kinetics of mutant strains under normal and stress conditions

    • Evaluate membrane permeability and antimicrobial susceptibility profiles

    • Measure virulence in cellular and animal infection models

This approach follows the experimental design principles outlined for complex biological investigations, ensuring proper controls, multiple measurement methods, and statistical validation of findings .

What methods should I use to express and purify recombinant Rv2091c/MT2152?

The expression and purification of membrane proteins like Rv2091c requires specialized approaches:

  • Expression System Selection:

    • E. coli strains specialized for membrane proteins (C41/C43(DE3), Lemo21)

    • Mycobacterial expression systems for native-like membrane environment

    • Cell-free expression systems with membrane mimetics

  • Construct Design:

    • Incorporate fusion tags that enhance solubility (MBP, SUMO, Trx)

    • Include TEV or PreScission protease sites for tag removal

    • Consider expressing functional domains separately if full-length expression is challenging

  • Expression Optimization:

    • Test induction conditions (temperature, inducer concentration, time)

    • Screen detergents for membrane protein extraction (DDM, LDAO, FC-12)

    • Evaluate nanodiscs or amphipols for maintaining native conformation

  • Purification Strategy:

    • Initial capture via affinity chromatography (Ni-NTA, Strep-tag)

    • Secondary purification through ion exchange or size exclusion

    • Quality assessment via SDS-PAGE, Western blotting, and mass spectrometry

  • Functional Validation:

    • Circular dichroism to verify secondary structure integrity

    • Thermal shift assays to assess stability in different conditions

    • Activity assays based on predicted function

This methodological approach builds on established protocols for membrane protein purification while addressing the specific challenges of mycobacterial membrane proteins .

How can surface biotinylation techniques be applied to studying Rv2091c?

Surface biotinylation represents a powerful approach for confirming the membrane localization and topology of Rv2091c:

  • Selective Biotinylation Protocol:

    • Culture M. tuberculosis under conditions where Rv2091c is expressed

    • Treat intact bacteria with membrane-impermeable biotinylation reagents (Sulfo-NHS-LC-Biotin)

    • Quench the reaction and wash extensively to remove excess reagent

    • Lyse cells and isolate biotinylated proteins using streptavidin affinity capture

    • Identify Rv2091c through Western blotting or mass spectrometry

  • Controls and Validation:

    • Include non-biotinylated controls to identify background binding

    • Use cytoplasmic protein markers to confirm membrane integrity during labeling

    • Perform comparative analysis with known surface proteins

    • Validate findings through complementary approaches (immunogold electron microscopy)

  • Topology Mapping:

    • Generate Rv2091c constructs with site-specific cysteine mutations

    • Apply membrane-impermeable thiol-reactive biotinylation reagents

    • Analyze labeling patterns to determine transmembrane orientation

This methodology has been successfully applied to characterize the surface-exposed proteome of other mycobacterial species, providing a roadmap for Rv2091c investigation .

What role might Rv2091c play in Mycobacterium tuberculosis pathogenesis?

While the exact function of Rv2091c remains uncharacterized, several lines of evidence suggest potential roles in pathogenesis:

  • Stress Response Involvement:

    • Upregulation in response to antimicrobial compounds (isoniazid, SRI#221, SRI#9190) indicates a role in bacterial adaptation to host-imposed stresses

    • Similar expression patterns to other stress-responsive membrane proteins suggests functional association with survival mechanisms

  • Membrane Integrity Hypothesis:

    • As a predicted membrane protein, Rv2091c may contribute to the unique cell envelope architecture of M. tuberculosis

    • The cell envelope is a critical virulence determinant that shields bacteria from host immune responses and antimicrobial compounds

  • Potential Host Interaction:

    • Some uncharacterized membrane proteins in M. tuberculosis have been found to interact with host components

    • These interactions can modulate immune recognition or facilitate nutrient acquisition within the host environment

  • Testing Approaches:

    • Compare transcription profiles of wild-type and Rv2091c-deficient strains during macrophage infection

    • Assess survival of mutant strains in models mimicking different aspects of tuberculosis pathogenesis

    • Evaluate effects on cell envelope composition and antimicrobial susceptibility

    • Screen for interactions with host factors using bacterial two-hybrid or pull-down assays

Understanding Rv2091c's role in pathogenesis requires integrating data from functional genomics, comparative biology, and host-pathogen interaction studies.

How can machine learning approaches assist in predicting Rv2091c function?

Machine learning (ML) offers powerful computational tools for generating functional hypotheses about uncharacterized proteins like Rv2091c:

  • Feature Extraction and Selection:

    • Convert protein sequence into numerical features (amino acid composition, physicochemical properties)

    • Generate position-specific scoring matrices from sequence alignments

    • Extract structural features from predicted 3D models

  • Supervised Learning Applications:

    • Train classifiers using proteins with known functions to predict potential roles of Rv2091c

    • Employ ensemble methods (random forests, gradient boosting) to improve prediction accuracy

    • Implement deep learning approaches for detecting subtle sequence-function relationships

  • Unsupervised Learning Approaches:

    • Apply clustering algorithms to group Rv2091c with functionally characterized proteins

    • Use dimensionality reduction techniques to visualize relationships between proteins

    • Implement self-organizing maps to identify functional neighborhoods

  • Integration with Experimental Data:

    • Incorporate gene expression data under various conditions to refine predictions

    • Use ML-based experimental design to prioritize conditions for testing

    • Develop hybrid models that combine sequence features with transcriptomic responses

This ML-driven approach parallels strategies successfully applied in other protein function prediction contexts, such as the rhodopsin characterization described in the literature .

What are the challenges and solutions in resolving data contradictions when studying Rv2091c?

Researchers studying Rv2091c may encounter seemingly contradictory data requiring careful resolution:

How can I develop antibodies against Rv2091c for research applications?

Developing specific antibodies against Rv2091c requires a strategic approach:

  • Antigen Design and Production:

    • Analyze the protein sequence to identify immunogenic epitopes (preferably surface-exposed)

    • Consider using full-length protein, selected domains, or synthetic peptides

    • Express recombinant antigen with appropriate tags for purification

    • Utilize the available recombinant protein preparations as starting material

  • Immunization Strategy:

    • Select appropriate animal models (rabbits for polyclonal, mice for monoclonal)

    • Design immunization schedules with proper adjuvants

    • Monitor antibody titers through ELISA during the immunization process

    • Collect and process serum or hybridoma supernatants

  • Antibody Purification and Validation:

    • Purify antibodies using affinity chromatography (protein A/G or antigen-specific)

    • Validate specificity through Western blotting against recombinant protein and M. tuberculosis lysates

    • Perform immunoprecipitation to confirm native protein recognition

    • Test cross-reactivity against related mycobacterial proteins

  • Application-Specific Optimization:

    • For immunofluorescence: determine optimal fixation and permeabilization conditions

    • For immunohistochemistry: establish antigen retrieval protocols

    • For flow cytometry: optimize antibody concentration and buffer conditions

    • For ELISA: develop standard curves and determine detection limits

Such antibodies would provide valuable tools for studying Rv2091c localization, expression patterns, and interactions with other cellular components.

How can I design a gene knockout experiment to study Rv2091c function?

A comprehensive gene knockout strategy for Rv2091c should follow these methodological steps:

  • Knockout Construct Design:

    • Create an allelic exchange substrate with upstream and downstream homology arms (~1kb each)

    • Replace the Rv2091c coding sequence with an antibiotic resistance marker

    • Include negative selection markers (sacB) for counter-selection

    • Incorporate unique restriction sites for screening

  • Transformation and Selection:

    • Transform the knockout construct into M. tuberculosis using electroporation

    • Select for single crossovers on media containing appropriate antibiotics

    • Counter-select for double crossovers on sucrose-containing media

    • Screen potential knockouts by PCR and Southern blotting

  • Validation of the Knockout Strain:

    • Confirm gene deletion by PCR across the deletion junction

    • Verify absence of Rv2091c mRNA by RT-PCR

    • Confirm lack of protein expression by Western blotting

    • Sequence the modified genomic region to ensure accurate recombination

  • Complementation Controls:

    • Reintroduce the Rv2091c gene at a neutral site or on an episomal vector

    • Use inducible promoters to control expression levels

    • Include epitope tags for tracking protein production

    • Confirm functional complementation through phenotypic rescue

  • Phenotypic Characterization:

    • Compare growth rates in standard and stress conditions

    • Assess antimicrobial susceptibility profiles, particularly to compounds that induce Rv2091c expression

    • Evaluate membrane integrity and composition

    • Test virulence in cellular and animal infection models

This systematic approach follows established protocols for genetic manipulation in mycobacteria while incorporating controls necessary for rigorous functional characterization .

What mass spectrometry approaches are optimal for studying Rv2091c?

Mass spectrometry (MS) offers powerful tools for characterizing Rv2091c at multiple levels:

  • Protein Identification and Verification:

    • Employ bottom-up proteomics with tryptic digestion followed by LC-MS/MS

    • Target unique peptides of Rv2091c for selective reaction monitoring (SRM)

    • Use high-resolution instruments (Orbitrap, QTOF) for accurate mass determination

    • Apply parallel reaction monitoring for improved sensitivity and selectivity

  • Post-translational Modification Analysis:

    • Implement enrichment strategies for phosphorylation, glycosylation, or lipidation

    • Use electron transfer dissociation (ETD) to preserve labile modifications

    • Apply neutral loss scanning for detecting specific modifications

    • Develop targeted methods for site-specific modification quantification

  • Protein-Protein Interaction Studies:

    • Combine immunoprecipitation or crosslinking with MS (IP-MS, XL-MS)

    • Implement SILAC or TMT labeling for quantitative interaction analysis

    • Use proximity labeling methods (BioID, APEX) coupled with MS

    • Analyze data with specialized software for interaction network visualization

  • Structural Characterization:

    • Apply hydrogen-deuterium exchange MS to probe structural dynamics

    • Utilize native MS to analyze oligomeric states and complex formation

    • Implement ion mobility MS for conformational analysis

    • Combine limited proteolysis with MS to identify flexible regions

  • Sample Preparation Considerations:

    • Optimize membrane protein extraction with appropriate detergents

    • Employ filter-aided sample preparation (FASP) for improved peptide recovery

    • Consider specialized digestion strategies beyond trypsin alone

    • Implement fractionation methods to increase proteome coverage

These MS approaches provide complementary data to other techniques, enhancing the comprehensive characterization of Rv2091c .

How should I interpret contradictory expression data regarding Rv2091c?

When faced with seemingly contradictory expression data for Rv2091c, follow these analytical steps:

  • Methodological Comparison:

    • Evaluate techniques used (microarray, RNA-seq, qPCR, proteomics)

    • Assess normalization methods and reference genes employed

    • Consider detection limits and dynamic range of each method

    • Examine statistical approaches used for significance determination

  • Experimental Condition Analysis:

    • Compare precise growth conditions (media composition, growth phase)

    • Note strain differences (H37Rv, CDC1551, clinical isolates)

    • Document exposure parameters (concentration, duration) for treatments

    • Consider batch effects and laboratory-specific variables

  • Resolution Strategies:

    • Perform meta-analysis using standardized effect sizes

    • Develop unified experimental protocols for validation

    • Test multiple strains under identical conditions

    • Implement orthogonal validation methods (e.g., protein levels for transcriptional data)

  • Biological Context Integration:

    • Consider temporal dynamics of expression responses

    • Evaluate co-expression patterns with functionally related genes

    • Assess relationship to known regulatory networks

    • Examine expression in the context of physiological state transitions

This systematic approach enables researchers to transform apparent contradictions into insights about condition-specific regulation of Rv2091c expression .

What bioinformatic pipelines are recommended for functional prediction of Rv2091c?

A comprehensive bioinformatic pipeline for Rv2091c functional prediction should include these components:

  • Sequence-Based Analysis:

    • Execute sensitive homology searches (PSI-BLAST, HMMer, HHpred)

    • Identify conserved domains and motifs (InterPro, Pfam, PROSITE)

    • Predict transmembrane topology (TMHMM, Phobius, TOPCONS)

    • Analyze sequence conservation patterns across mycobacterial species

  • Structural Prediction and Analysis:

    • Generate protein structure models (AlphaFold2, I-TASSER, SWISS-MODEL)

    • Evaluate model quality using metrics like QMEAN, MolProbity

    • Identify potential binding pockets using CASTp, FTMap

    • Perform molecular dynamics simulations to assess stability and dynamics

  • Functional Inference:

    • Apply machine learning-based function prediction tools (DeepFRI, COFACTOR)

    • Analyze gene neighborhood and operonic context across genomes

    • Examine phylogenetic profiles for functional associations

    • Implement protein-protein interaction prediction methods

  • Integration and Visualization:

    • Combine multiple predictive approaches using ensemble methods

    • Weight predictions based on confidence scores and method reliability

    • Visualize results through interactive dashboards and network diagrams

    • Document prediction provenance and confidence metrics

  • Experimental Validation Planning:

    • Translate predictions into testable hypotheses

    • Design targeted assays based on highest-confidence predictions

    • Prioritize experiments that can distinguish between alternative functional models

    • Implement iterative refinement as new data becomes available

This multi-layered approach leverages complementary predictive methods to generate robust functional hypotheses for experimental testing .

What emerging technologies show promise for studying uncharacterized proteins like Rv2091c?

Several cutting-edge technologies offer new approaches for characterizing proteins like Rv2091c:

  • Advanced Structural Biology Methods:

    • Cryo-electron tomography for in situ structural visualization

    • Integrative structural biology combining multiple data sources

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Serial femtosecond crystallography using X-ray free electron lasers

  • Single-Cell and Spatial Technologies:

    • Single-cell RNA-seq to capture expression heterogeneity

    • Spatial transcriptomics to map expression within granulomas

    • Mass cytometry for high-dimensional protein profiling

    • Correlative light and electron microscopy for functional localization

  • Protein Engineering Approaches:

    • CRISPR interference for precise transcriptional control

    • Proximity labeling methods (TurboID, APEX) for interaction mapping

    • Optogenetic control of protein activity

    • Degron systems for targeted protein degradation

  • High-Throughput Functional Screening:

    • CRISPR-based genetic screens in mycobacteria

    • Microfluidic-based phenotypic screening

    • Deep mutational scanning for structure-function analysis

    • Cell-free expression systems for functional characterization

  • Computational Advances:

    • AI-driven protein function prediction

    • Molecular dynamics simulations at biologically relevant timescales

    • Network-based approaches for functional inference

    • Quantum computing applications for molecular modeling

These emerging technologies promise to overcome current limitations in studying challenging proteins like Rv2091c, potentially accelerating functional characterization and drug development efforts .

How might understanding Rv2091c contribute to tuberculosis treatment strategies?

Elucidating the function of Rv2091c could impact tuberculosis treatment strategies in several ways:

  • Drug Target Potential:

    • As a membrane protein upregulated in response to current antibiotics, Rv2091c may represent a novel drug target

    • Its role in stress response suggests targeting it might enhance efficacy of existing antimicrobials

    • If essential under specific in vivo conditions, it could represent a vulnerability for targeted therapy

    • Structural characterization could enable structure-based drug design approaches

  • Diagnostic Applications:

    • Expression patterns could serve as biomarkers for specific drug responses

    • Antibodies against Rv2091c might detect particular physiological states of M. tuberculosis

    • Changes in Rv2091c levels could indicate development of drug tolerance or resistance

    • Integration into multiplexed diagnostic platforms could improve treatment monitoring

  • Vaccine Development Implications:

    • If surface-exposed, Rv2091c could represent an antigen for vaccine development

    • Understanding its role in pathogenesis might reveal immune evasion mechanisms

    • Strain variations in Rv2091c could inform design of broadly protective vaccines

    • Knowledge of structure and function could guide rational antigen design

  • Precision Medicine Approaches:

    • Rv2091c expression patterns could help stratify infections for treatment selection

    • Patient-specific immune responses to Rv2091c might predict treatment outcomes

    • Combining Rv2091c-targeted approaches with existing regimens could enable shorter treatments

    • Understanding its network interactions could reveal combination therapy strategies

This research highlights how basic science investigations of uncharacterized proteins contribute to the translational pipeline for addressing this global health challenge .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.