Recombinant Uncharacterized protein Rv2197c/MT2253 (Rv2197c, MT2253)

Shipped with Ice Packs
In Stock

Description

Production & Purification

The protein is manufactured through standardized recombinant protocols :

Production ParameterSpecification
Expression VectorpET-based system
Purification MethodNi-NTA affinity
Buffer CompositionTris/PBS + 6% Trehalose
Reconstitution0.1-1.0 mg/mL in sterile water

Critical quality control includes SDS-PAGE verification and mass spectrometry validation .

Functional Profile

While functionally uncharacterized, experimental data suggests:

  • Potential involvement in mycobacterial membrane organization due to predicted transmembrane domains

  • Interaction capabilities detected through:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation assays

Stability Profile:

ConditionPerformance
Freeze-Thaw CyclesNot recommended
Short-Term Storage4°C (1 week)
Long-Term Storage-80°C (aliquoted)

Research Applications

Validated uses include :

ApplicationExperimental Use
Vaccine DevelopmentAntigen characterization studies
Protein InteractionPull-down assay component
Diagnostic ResearchELISA antigen (50 µg commercial formats)
Structural BiologyCrystallization trials

Current Research Directions

  1. Drug Target Validation: Investigating its role in M. tuberculosis persistence mechanisms

  2. Host-Pathogen Interactions: Mapping interaction networks using phage display libraries

  3. Diagnostic Potential: Evaluating serum reactivity in TB patients vs controls

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Target Names
Rv2197c, MT2253
Target Protein Sequence
MVSRYSAYRRGPDVISPDVIDRILVGACAAVWLVFTGVSVAAAVALMDLGRGFHEMAGNP HTTWVLYAVIVVSALVIVGAIPVLLRARRMAEAEPATRPTGASVRGGRSIGSGHPAKRAV AESAPVQHADAFEVAAEWSSEAVDRIWLRGTVVLTSAIGIALIAVAAATYLMAVGHDGPS WISYGLAGVVTAGMPVIEWLYARQLRRVVAPQSS
Uniprot No.

Q&A

What is Rv2197c/MT2253 and why is it significant for tuberculosis research?

Rv2197c is a conserved membrane protein found in Mycobacterium tuberculosis H37Rv, with MT2253 being its corresponding identifier in some annotation systems. The protein is 215 amino acids in length and is encoded by a gene spanning 2461504-2462148 bp on the negative strand of the M. tuberculosis genome . Its significance stems from being one of many uncharacterized proteins in the tuberculosis pathogen that may play important roles in bacterial survival, virulence, or drug resistance. Understanding such proteins is crucial for developing new therapeutic approaches against tuberculosis, particularly as drug resistance continues to emerge in clinical settings.

What computational tools are recommended for initial characterization of Rv2197c?

For initial in silico characterization of Rv2197c, a multi-faceted computational approach is recommended. Begin with physicochemical characterization using tools like ProtParam to determine properties such as molecular weight, theoretical pI, instability index, and GRAVY values . For subcellular localization prediction, employ PSORTb to classify whether the protein is cytoplasmic, membrane-associated, or secreted . Additional analyses should include transmembrane helix prediction (TMHMM), signal peptide prediction (SignalP 5.0), conserved domain identification (CDD search), and homology modeling if appropriate template structures are available. Comparative genomic analysis with orthologs identified in related mycobacterial species (such as MAP1937c, MAV_2294, MSMEG_4264) can provide evolutionary context and functional hints .

How can the stability and solubility of recombinant Rv2197c be optimized?

Optimizing the stability and solubility of recombinant Rv2197c requires a multi-faceted approach. First, expression temperature modulation is critical—lowering the temperature to 16-25°C often improves folding by slowing translation rate . Second, consider optimizing the coding sequence for the expression host while being mindful that excessive optimization can sometimes be counterproductive; maintaining some rare codons may actually improve folding by creating translational pauses . Third, employ fusion partners like SUMO, MBP, or thioredoxin that enhance solubility. Fourth, fine-tune inducer concentration to prevent overwhelming the cell's protein folding machinery—lower IPTG concentrations (0.01-0.1 mM) often yield more soluble protein than standard 1 mM concentrations . Finally, optimize the growth media and buffer conditions during purification, incorporating appropriate detergents (mild non-ionic detergents like DDM or LMNG) for membrane protein extraction while maintaining native-like conditions.

What strategies can address the metabolic burden during recombinant expression of Rv2197c?

Addressing metabolic burden during Rv2197c expression requires balancing recombinant protein production with host cell viability. Implement a CRISPR-based strategy to create libraries of bacterial hosts with variable ribosomal binding site sequences for the expression machinery, resulting in different capacities to express the target protein . This approach recognizes that lower expression levels of difficult-to-produce proteins often yield higher amounts of functional protein. Alternatively, develop a system that separates metabolic requirements for cell growth from those needed for protein expression—for example, using phosphate concentration as a metabolic switch to transition from reducing to oxidizing conditions at appropriate growth phases . For membrane proteins like Rv2197c, consider a dual-plasmid system where one plasmid contains the target gene while another contains genes encoding chaperones or foldases that assist in proper folding. Finally, optimize the translation efficiency through mRNA secondary structure modifications that reduce ribosome stalling while avoiding excessive translation rates that might overwhelm the membrane insertion machinery .

How can researchers differentiate between protein misfolding and toxicity when Rv2197c expression fails?

Differentiating between protein misfolding and toxicity requires systematic troubleshooting. First, monitor growth curves after induction—immediate growth arrest suggests toxicity, while gradual decline may indicate progressive accumulation of misfolded protein . Second, examine protein localization through fractionation experiments—if the protein accumulates in inclusion bodies, misfolding is likely the primary issue; if minimal protein is detected despite growth inhibition, toxicity may be dominant. Third, implement a time-course analysis of expression using Western blotting to determine if the protein is being expressed initially and then degraded (suggesting misfolding) or if expression is minimal from the start (suggesting transcriptional/translational inhibition due to toxicity). Fourth, employ flow cytometry with fluorescent stress reporters to measure cellular stress responses—sigma32-dependent heat shock response activation suggests misfolding, while SOS response activation may indicate toxicity . Finally, sequence the expression construct from colonies that survive induction—mutations in promoter regions suggest selection against toxic expression, whereas mutations in the coding sequence may indicate selection against misfolding-induced stress.

How can researchers determine if Rv2197c is a potential drug target or vaccine candidate?

Evaluating Rv2197c as a potential therapeutic target requires a comprehensive approach integrating computational prediction with experimental validation. Begin with essentiality assessment through genome-wide transposon mutagenesis data or CRISPR interference in M. tuberculosis. Conduct comparative genomics analysis to determine conservation across clinical isolates and absence in host (human) proteome—Rv2197c shows approximately 99.7% non-homology to human proteins, making it promising from this perspective . For vaccine potential, analyze properties including antigenicity (approximately 36-41% of hypothetical proteins from M. tuberculosis strains demonstrate antigenicity), allergenicity (Rv2197c appears non-allergenic based on similar proteins), and subcellular localization (membrane proteins are often accessible to immune surveillance) . Experimentally, validate immunogenicity through T-cell activation assays and evaluate protection in animal models. For drug target potential, develop assays to measure protein function, then conduct high-throughput screens against compound libraries. Target validation should include genetic knockdown experiments correlating with pharmacological inhibition phenotypes. Finally, assess structural druggability through binding site analysis, focusing on surface pockets that could accommodate small molecules while maintaining selectivity against human proteins.

What are the most effective approaches for functional characterization of Rv2197c?

Functional characterization of Rv2197c requires an integrated approach combining computational prediction with targeted experiments. Begin with computational analysis including gene neighborhood examination, protein-protein interaction predictions, and evolutionary coupling analysis to identify potential functional partners. Construct a gene deletion or CRISPR interference mutant in M. tuberculosis or suitable surrogate (M. smegmatis expressing Rv2197c) and perform comprehensive phenotypic profiling under various stress conditions relevant to tuberculosis pathogenesis. Employ transcriptomic and proteomic analyses comparing wild-type and mutant strains to identify perturbed pathways. For biochemical characterization, purify the protein with appropriate detergents or nanodiscs to maintain native conformations and perform targeted assays based on computational predictions—potential functions for membrane proteins include transport, signaling, or enzymatic activities. Consider identifying binding partners through proximity-based approaches like BioID or APEX2 labeling in mycobacterial systems. For transport function assessment, reconstitute purified protein in proteoliposomes and test substrate transport using fluorescent probes or radiolabeled compounds. Finally, apply in vivo imaging techniques using fluorescent protein fusions to determine subcellular localization and dynamics during infection.

What detergent screening strategy is most effective for solubilizing Rv2197c while maintaining function?

Developing an effective detergent screening strategy for Rv2197c requires systematic evaluation of multiple parameters affecting membrane protein stability. Begin with a primary screen using a panel of detergents spanning different physicochemical properties—mild non-ionic detergents (DDM, LMNG, UDM), zwitterionic detergents (LDAO, Fos-choline), and harsh detergents (SDS, Triton X-100) at concentrations 2-5× their critical micelle concentration (CMC). Analyze solubilization efficiency via Western blotting of supernatant versus pellet fractions after ultracentrifugation. For promising candidates, conduct a secondary screen evaluating protein stability over time (24-72 hours) using size-exclusion chromatography to monitor aggregation and oligomeric state. Implement a tertiary functional screen using activity assays or thermal stability measurements (such as differential scanning fluorimetry) to identify detergents that maintain the protein in a functional state. Consider detergent mixtures or addition of lipids as stabilizing factors, since native lipid interactions are often critical for membrane protein function. For particularly challenging cases, explore alternative solubilization systems including styrene maleic acid lipid particles (SMALPs), nanodiscs, or amphipols that better mimic the native membrane environment compared to conventional detergents. Document the complete optimization process systematically, as the conditions required for initial solubilization may differ from those optimal for long-term stability and functional studies.

How can researchers overcome codon bias challenges when expressing Rv2197c in heterologous systems?

Addressing codon bias challenges when expressing mycobacterial proteins like Rv2197c in heterologous systems requires nuanced optimization rather than simple codon harmonization. While conventional wisdom suggests optimizing all codons for the expression host, recent studies indicate that strategic retention of certain rare codons can improve folding by creating beneficial translational pauses . Begin by analyzing the Rv2197c sequence for regions predicted to form defined structural elements (transmembrane helices, loops) and consider maintaining the natural codon usage pattern at domain boundaries while optimizing highly repetitive rare codon clusters elsewhere. Testing multiple constructs with varying degrees of optimization is recommended—fully optimized, partially optimized maintaining natural pause sites, and wild-type sequences. When using E. coli expression systems, supplement with plasmids that express rare tRNAs (like pRARE) to accommodate mycobacterial codon preferences. Monitor the effect of codon modifications not only on total protein yield but also on solubility and function, as higher expression levels often come at the expense of proper folding. Additionally, optimize the 5' mRNA region to reduce secondary structures that might impair translation initiation while being cautious not to create oversaturating translation efficiency that could overwhelm the membrane insertion machinery . For membrane proteins like Rv2197c, slower translation rates often favor proper membrane integration and folding, making balanced rather than maximal codon optimization the preferred strategy.

What purification strategy yields the highest purity and activity for recombinant Rv2197c?

Purifying membrane proteins like Rv2197c to high homogeneity while preserving activity requires a carefully designed multi-step approach. Begin with affinity chromatography using N- or C-terminal tags positioned to avoid interference with membrane topology—for Rv2197c, consider a C-terminal His-tag as its predicted topology suggests the C-terminus is cytoplasmic. During solubilization and affinity purification, include lipids (0.1-0.5 mg/mL) and cholesterol hemisuccinate (CHS, 0.1%) as stabilizing agents. Following initial capture, implement an intermediate purification step using ion exchange chromatography under conditions determined by the protein's theoretical pI (selecting cation or anion exchange appropriately). For final polishing and oligomeric state assessment, perform size exclusion chromatography using a buffer optimized for stability—typically containing reduced detergent concentration (just above CMC), glycerol (10-20%), and stabilizing additives identified during optimization screens. Throughout purification, monitor protein quality using multiple techniques: SDS-PAGE for purity, Western blotting for identity, dynamic light scattering for homogeneity, and thermal stability assays for integrity. If functional assays are available, track specific activity at each purification stage to identify steps causing activity loss. For challenging proteins, consider on-column detergent exchange during affinity purification or transitioning to more stabilizing systems like nanodiscs or amphipols during later purification stages. Document detailed buffer compositions, yields, and specific activities at each step to facilitate protocol refinement and reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.