Recombinant Uncharacterized protein Rv2203/MT2259 (Rv2203, MT2259)

Shipped with Ice Packs
In Stock

Description

General Information

Rv2203/MT2259 is a protein that, as the name suggests, has not been fully characterized . The recombinant form of this protein is often produced in host organisms such as E. coli for research purposes .

Table 1: General Information of Recombinant Uncharacterized Protein Rv2203/MT2259

FeatureDescription
Official Full NameUncharacterized protein Rv2203/MT2259 (Rv2203, MT2259)
UniProt IDP64949
SpeciesHuman
SourceE. coli
TagHis-tagged
Protein LengthFull Length (1-230 amino acids)
FormLyophilized powder
PurityGreater than 85% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) is recommended for long-term storage at -20℃/-80℃.

Production and Characteristics

The recombinant protein is produced in E. coli and tagged with Histidine (His) to facilitate purification . The protein's molecular weight is approximately 135 kDa, and it exhibits a multimeric structure comprising trimers and hexamers, which can bind to the ACE2 receptor .

Potential Functions and Interactions

While the specific function of Rv2203/MT2259 remains uncharacterized, studies suggest its involvement in various pathways and interactions with other proteins and molecules . Identifying interacting proteins is achieved through methods like yeast two-hybrid assays, co-immunoprecipitation (co-IP), and pull-down assays .

Role in Mycobacterium tuberculosis

Rv2203/MT2259 is found in Mycobacterium tuberculosis (Mtb) . Research indicates that proteins like Rv1417 and Rv2617c interact with the exported repetitive protein (Erp), a virulence factor in Mtb . These interactions are linked to bacterial replication and preventing bacterial injury from oxidative stress . Understanding these interactions could provide insights into new antitubercular compounds that might bind to Rv1636 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Target Names
Rv2203, MT2259
Target Protein Sequence
MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPG VPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGY LNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWS QYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY
Uniprot No.

Q&A

What is Rv2203 and what are its basic characteristics?

Rv2203 (also designated as MT2259) is a possible membrane protein found in Mycobacterium tuberculosis. It is classified as part of the cell wall and cell processes functional category, with the following key characteristics:

FeatureDescription
ProductPossible membrane protein
Feature TypeCDS
Genomic Position2468231-2468923
Strand+
Length693 nucleotides
Amino Acid Length230 residues
Transcription FactorFALSE

The protein is currently labeled as "uncharacterized" because its precise biological function has not been fully elucidated . Bioinformatic analysis suggests it contains transmembrane domains consistent with membrane localization, supporting its annotation as a probable membrane protein.

What expression systems are commonly used for producing recombinant Rv2203?

Recombinant Rv2203 can be produced using several expression systems, each with advantages and limitations:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay form inclusion bodies requiring refolding, potential issues with membrane protein folding
YeastBetter for membrane proteins, eukaryotic post-translational modificationsLonger expression time, more complex media requirements
BaculovirusExcellent for membrane proteins, high yieldsMore technically demanding, higher cost
Mammalian cell linesMost authentic post-translational modificationsLower yields, highest cost, longest expression time
Cell-free expressionAvoids toxicity issues, direct access to reaction conditionsLower yields, higher cost per mg protein

For structural studies, E. coli or cell-free expression systems are commonly used, while functional studies may benefit from expression in eukaryotic systems. All systems typically achieve ≥85% purity as determined by SDS-PAGE .

What is known about the gene regulation and expression patterns of Rv2203 in M. tuberculosis?

Rv2203 appears to be subject to specific regulatory controls within the M. tuberculosis genome. Research indicates:

  • It is predicted to be co-regulated in modules bicluster_0084 (with residual 0.58) and bicluster_0253 (with residual 0.45)

  • This regulation may be mediated by de-novo identified cis-regulatory motifs with e-values of 0.64 and 170.00 for bicluster_0084, and 18.00 and 8,100.00 for bicluster_0253

  • These modules show enrichment for GO terms related to nucleobase-containing compound kinase activity

  • The gene has been identified as relevant for growth on cholesterol, suggesting potential involvement in lipid metabolism pathways

Although global transcription analysis studies of M. tuberculosis have been conducted, specific expression data for Rv2203 under different conditions requires further investigation . Researchers examining Rv2203 regulation should consider analyzing its expression patterns during different growth phases, nutrient limitations, and exposure to host-relevant stresses.

What purification strategies are most effective for recombinant Rv2203?

Purifying membrane proteins like Rv2203 presents specific challenges. Based on current methodologies for similar mycobacterial membrane proteins, the following purification strategy is recommended:

  • Extraction optimization: Use a detergent screening approach to identify optimal solubilization conditions (common detergents include DDM, LDAO, and C12E8)

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using the His-tag present in recombinant constructs

  • Intermediate purification: Ion exchange chromatography to remove contaminants

  • Polishing step: Size exclusion chromatography to achieve high purity and remove protein aggregates

  • Quality control: Assess purity using SDS-PAGE (target ≥85% purity) and verify identity by mass spectrometry

For challenging applications requiring higher purity, additional chromatography steps may be necessary. For membrane proteins like Rv2203, maintaining the protein in appropriate detergent micelles throughout purification is critical for stability and function .

How can researchers investigate the potential function of Rv2203 in M. tuberculosis?

Given that Rv2203 remains uncharacterized, several complementary approaches can be used to investigate its function:

  • Genetic manipulation:

    • Generate knockout mutants using techniques similar to those used for other M. tuberculosis genes (as described for Rv1395, Rv1931c, virS, and Rv3736)

    • Create conditional knockdowns if the gene proves essential

    • Perform complementation studies to verify phenotypes

  • Phenotypic characterization:

    • Assess growth in different media conditions, particularly those containing cholesterol

    • Examine cell wall integrity and composition

    • Test susceptibility to various antibiotics, particularly those targeting cell envelope

    • Evaluate survival under stress conditions (oxidative, acidic, nutrient limitation)

  • Transcriptomic and proteomic analysis:

    • Compare gene expression profiles between wild-type and Rv2203 mutant strains

    • Identify proteins that interact with Rv2203 using pull-down assays coupled with mass spectrometry

    • Examine changes in the membrane proteome in Rv2203 mutants

  • Structural biology approaches:

    • Determine the 3D structure using X-ray crystallography or cryo-EM

    • Perform molecular dynamics simulations to predict functional domains

These approaches should be integrated to build a comprehensive understanding of Rv2203's role in M. tuberculosis biology .

What methods can be used to study protein-protein interactions involving Rv2203?

Understanding the interaction partners of Rv2203 is crucial for elucidating its function. Several complementary techniques can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged Rv2203 in M. tuberculosis

    • Solubilize membranes with appropriate detergents

    • Pull down Rv2203 complexes and identify interacting partners by mass spectrometry

  • Bacterial two-hybrid systems:

    • Adapt systems for membrane proteins (such as BACTH)

    • Screen against a library of M. tuberculosis proteins

    • Validate positive interactions with secondary assays

  • Proximity-dependent labeling:

    • Fuse Rv2203 to BioID or APEX2

    • Express in mycobacteria and allow proximity labeling

    • Identify labeled proteins by streptavidin pulldown and mass spectrometry

  • Surface plasmon resonance (SPR):

    • Use purified recombinant Rv2203 immobilized on sensor chips

    • Test interaction with candidate proteins identified from other methods

    • Determine binding kinetics and affinity constants

  • Chemical crosslinking coupled with mass spectrometry:

    • Apply membrane-permeable crosslinkers to intact cells or membrane preparations

    • Enrich for Rv2203-containing complexes

    • Identify crosslinked peptides by specialized mass spectrometry techniques

For membrane proteins like Rv2203, detergent selection is critical for maintaining native interactions during these experiments.

How might Rv2203 contribute to M. tuberculosis pathogenesis?

While direct evidence linking Rv2203 to virulence is limited, several lines of investigation could reveal its potential role in pathogenesis:

  • Infection models:

    • Compare wild-type and Rv2203 mutant strains in macrophage infection assays

    • Assess bacterial survival, replication, and host cell responses

    • Evaluate performance in animal models (mice, guinea pigs) if in vitro results are promising

  • Host-pathogen interaction:

    • Investigate whether Rv2203 interacts with specific host factors

    • Determine if it modulates host immune responses or cellular processes

    • Assess its role in bacterial adaptation to the host environment

  • Expression analysis during infection:

    • Monitor Rv2203 expression levels during different stages of infection

    • Compare expression in active vs. latent infection models

    • Identify conditions that upregulate or downregulate the gene

Since Rv2203 is a membrane protein associated with cell wall processes, it may play roles in:

  • Maintaining cell envelope integrity under host stress conditions

  • Participating in nutrient acquisition (particularly cholesterol metabolism)

  • Contributing to cell wall remodeling during different infection phases

  • Potential immune evasion mechanisms

Systematic investigation using these approaches would help define Rv2203's contribution to M. tuberculosis pathogenesis .

What structural and functional validation methods should be applied to recombinant Rv2203?

To ensure recombinant Rv2203 preparations represent the native protein in both structure and function, several validation methods should be implemented:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to identify folded domains

    • Mass spectrometry to verify protein mass and potential modifications

  • Functional validation:

    • Reconstitution into liposomes to assess membrane integration

    • Binding assays with potential ligands (particularly cholesterol-related compounds)

    • Activity assays if enzymatic function is predicted

    • Complementation studies in Rv2203 knockout strains

  • Quality control metrics:

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

    • Dynamic light scattering (DLS) to evaluate sample homogeneity

    • Negative-stain electron microscopy to visualize protein particles

For recombinant membrane proteins like Rv2203, validation should include verification that the protein has been correctly inserted into detergent micelles or membrane mimetics with the expected topology .

How can recombinant Rv2203 be applied in tuberculosis research and potential therapeutic development?

Recombinant Rv2203 protein has several potential applications in both basic and translational tuberculosis research:

  • Diagnostic development:

    • Evaluate Rv2203 as a potential biomarker for TB infection

    • Develop antibodies against Rv2203 for immunodiagnostic applications

    • Assess presence of anti-Rv2203 antibodies in patient sera as diagnostic indicators

  • Vaccine research:

    • Test Rv2203 as a potential antigen in subunit vaccine formulations

    • Evaluate immune responses to Rv2203 in animal models

    • Determine if Rv2203-specific immune responses correlate with protection

  • Drug target validation:

    • Develop high-throughput screening assays using recombinant Rv2203

    • Identify small molecules that bind Rv2203 and disrupt its function

    • Validate hits using structure-function studies and in vivo efficacy models

  • Structural biology:

    • Determine the 3D structure to inform rational drug design

    • Identify potential binding pockets for small molecule inhibitors

    • Use structure to predict functional mechanisms

  • Immunological research:

    • Characterize host immune responses to Rv2203

    • Determine if Rv2203 modulates host immune function

    • Investigate potential antigenic properties for immune detection

Since Rv2203 appears to be involved in cholesterol utilization, which is critical for M. tuberculosis persistence in the host, it represents a potentially attractive target for therapeutic development aimed at disrupting this important metabolic pathway .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.