The Recombinant Uncharacterized protein Rv2206/MT2262 is a protein derived from Mycobacterium tuberculosis, a bacterium responsible for tuberculosis (TB), a major global health concern. This protein is identified by the locus names Rv2206 and MT2262 in different strains of M. tuberculosis. Despite its designation as "uncharacterized," research into this protein is crucial for understanding its potential roles in bacterial physiology and pathogenesis.
Expression and Production: This protein is produced using recombinant DNA technology, often expressed in cell-free systems or other host organisms. The recombinant form allows for the study of its structure and function in a controlled environment .
Sequence and Structure: The full-length protein consists of 236 amino acids, with a specific sequence that includes several conserved regions. The amino acid sequence is MKLLGHRKSHGHQRADASPDAGSKDGCRPDSGRTSGSDTSRGSQTTGPKGRPTPKRNQSR RHTKKGPVAPAPMTAAQARARRKSLAGPKLSREERRAEKAANRARMTERRERMMAGEEAY LLPRDRGPVRRYVRDVVDSRRNLLGLFMPSALTLLFVMFAVPQVQFYLSPAmLILLALMT IDAIILGRKVGRLVDTKFPSNTESRWRLGLYAAGRASQIRRLRAPRPQVERGGDVG .
Storage and Handling: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability. Repeated freezing and thawing should be avoided .
Future studies could focus on elucidating the specific functions of Rv2206/MT2262, potentially through biochemical assays, structural analysis, or genetic manipulation of M. tuberculosis strains. Understanding its role could provide insights into novel targets for TB treatment or diagnostic tools.
The most established expression system for Rv2206/MT2262 is E. coli, typically with an N-terminal His-tag for purification purposes. The recombinant protein is generally expressed as a full-length construct (1-236 amino acids) and purified to ≥90% purity as determined by SDS-PAGE .
Despite being classified as "uncharacterized," genetic studies have implicated Rv2206/MT2262 in phagosome maturation arrest during M. tuberculosis infection of macrophages. Rv2206 mutants fail to properly arrest phagosome maturation, demonstrating significantly reduced colocalization with early endosomal markers (dextran and transferrin) and increased colocalization with late endosomal/lysosomal markers (LBPA and LAMP-2) compared to wild-type strains .
For optimal stability, the recombinant Rv2206/MT2262 protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use. Repeated freeze-thaw cycles should be strictly avoided. Working aliquots can be maintained at 4°C for up to one week. The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .
The recommended reconstitution protocol involves:
Brief centrifugation of the vial prior to opening to bring contents to the bottom
Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Addition of glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)
Based on published methodologies, researchers can:
Generate Rv2206 mutant strains using transposon mutagenesis or targeted gene disruption
Infect macrophages (typically bone marrow-derived macrophages) with wild-type and mutant strains
Assess phagosome maturation by:
Pulse-labeling with fluorescent dextran or transferrin (early endosomal markers)
Immunofluorescence labeling for LAMP-2 and LBPA (late endosomal markers)
Modified acid-fast staining to visualize mycobacteria
Quantification of colocalization using fluorescence deconvolution microscopy
This approach allows for quantitative assessment of phagosomal trafficking differences between wild-type and mutant strains .
Colocalization data should be analyzed using the following approach:
Collect z-stacks (typically 5-μm) centered on mycobacterial bacilli for at least 70 infected macrophages per condition
Deconvolve and analyze stacks using appropriate software (e.g., SoftWoRx)
Quantify fraction colocalization from multiple independent infections (minimum of 200 individual phagosomes)
Use Student's t-test to determine statistical significance compared to wild-type
The following table shows representative colocalization data for Rv2206 mutants compared to controls:
| Strain | Time postinfection (h) | Fraction colocalization with markers |
|---|---|---|
| Dextran (Avg±SD) | ||
| Controls | ||
| Erdman live | 24 | 0.654±0.045 |
| 72 | 0.667±0.047 | |
| Erdman heat killed | 24 | 0.320±0.045 |
| 72 | 0.308±0.059 | |
| Rv2206::Tn | ||
| 24 | 0.390±0.056 | |
| 72 | 0.376±0.080 |
This pattern indicates that Rv2206 mutants fail to arrest phagosome maturation, resembling the phenotype of heat-killed bacteria rather than live wild-type bacteria .
When encountering contradictory data regarding Rv2206/MT2262 function, researchers should:
Implement a systematic approach to identify inconsistencies using a notation of contradiction patterns
Consider three key parameters:
α: number of interdependent items
β: number of contradictory dependencies
θ: minimal number of required Boolean rules to assess contradictions
Check for common sources of contradictions:
Different experimental systems (in vitro vs. in vivo)
Different macrophage types (human vs. mouse, primary vs. cell lines)
Variations in infection protocols (MOI, timing)
Different detection methods for phagosomal markers
Implement structured classification of contradiction patterns to effectively scope different patterns across domains
Studies indicate that Rv2206/MT2262 plays a crucial role in M. tuberculosis pathogenesis by:
Contributing to phagosome maturation arrest, a key virulence mechanism
Affecting bacterial survival in macrophages (Rv2206 mutants show impaired intracellular survival)
Potentially influencing virulence in animal infection models
Genetic screens have identified Rv2206 mutants as defective for survival in macrophages, with quantitative data showing significant attenuation compared to wild-type strains. This suggests that targeting this protein might represent a potential strategy for developing new anti-tuberculosis approaches .
Advanced characterization approaches should include:
Structural biology studies:
X-ray crystallography or cryo-EM to determine the three-dimensional structure
Membrane protein structural analysis techniques for transmembrane domain characterization
Protein-protein interaction studies:
Bacterial two-hybrid systems
Co-immunoprecipitation coupled with mass spectrometry
Proximity labeling approaches (BioID, APEX)
Functional genomics:
RNA-seq to identify transcriptional changes in Rv2206 mutants
ChIP-seq if DNA-binding properties are suspected
Conditional depletion systems to study essentiality and temporal requirements
Cell biology approaches:
Researchers should consider:
For antibody production:
Select antigenic regions based on computational prediction of surface exposure
Consider using fragments rather than the full-length protein due to transmembrane domains
Validate antibody specificity using knockout strains as negative controls
For interaction studies:
Maintain appropriate detergent concentrations to preserve native conformation
Use mild solubilization conditions that maintain protein-protein interactions
Consider incorporating the protein into nanodiscs or liposomes to maintain membrane context
Include appropriate controls for non-specific interactions with the His-tag
For functional reconstitution:
Rv2206/MT2262 research contributes to our understanding of M. tuberculosis pathogenesis through:
Expanding knowledge about mechanisms of phagosome maturation arrest, which is critical for intracellular survival
Adding to the repertoire of known virulence factors that can be targeted for intervention
Providing insights into membrane-associated proteins that contribute to host-pathogen interactions
Supporting systems biology approaches to understand the complex networks involved in tuberculosis pathogenesis
Studies of this protein complement other research on secretion systems, cell wall components, and metabolic adaptations that collectively enable M. tuberculosis to establish persistent infection .
Researchers should implement systematic experimental design principles including:
Define variables clearly:
Independent variable: Presence/absence of functional Rv2206/MT2262
Dependent variables: Phagosomal markers, bacterial survival, host cell responses
Control for extraneous variables like macrophage activation state
Formulate specific, testable hypotheses about the role of Rv2206/MT2262 in:
Phagosomal trafficking
Host immune evasion
Bacterial survival mechanisms
Design appropriate experimental treatments:
Gene knockout/knockdown vs. complementation
Point mutations to identify critical residues
Controlled expression systems
Group assignment considerations:
Between-subjects design for comparing different bacterial strains
Within-subjects design for time-course experiments
Measurement protocols: