Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Target Names
Rv2237, MT2296
Target Protein Sequence
MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV
Uniprot No.

Q&A

What is Uncharacterized protein Rv2237/MT2296?

Uncharacterized protein Rv2237/MT2296 is a 255-amino acid protein encoded by the Rv2237 gene in the Mycobacterium tuberculosis genome. As suggested by its name, this protein's precise biological function remains to be fully elucidated through experimental characterization. The protein has been identified through genomic sequencing and is cataloged in protein databases with UniProt ID P64957 . The protein is part of the extensive proteome of M. tuberculosis, the causative agent of tuberculosis, which remains a significant global health concern. Preliminary analysis suggests it may be involved in metabolic processes, similar to other mycobacterial proteins, though specific pathway associations are still under investigation.

How is recombinant Rv2237/MT2296 protein typically expressed and purified?

The recombinant Rv2237/MT2296 protein is commonly expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The standard expression protocol involves:

  • Cloning the Rv2237 gene into a suitable expression vector

  • Transformation into competent E. coli cells

  • Induction of protein expression using IPTG or similar inducers

  • Cell lysis and extraction of protein

  • Purification via immobilized metal affinity chromatography (IMAC) utilizing the His-tag

  • Further purification steps as needed, such as size exclusion chromatography

The purified protein is typically obtained at >90% purity as determined by SDS-PAGE analysis and is available in lyophilized form for research applications . The protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage stability.

What experimental approaches are most effective for determining the function of uncharacterized proteins like Rv2237/MT2296?

Determining the function of uncharacterized proteins requires an integrated multi-omics approach:

  • Comparative Genomics: Analysis of gene neighborhood and conservation across related species can provide functional context. For mycobacterial proteins, comparison across different Mycobacterium species offers evolutionary insights into functional conservation .

  • Transcriptomic Analysis: RNA-seq studies examining expression patterns under various conditions (nutrient limitation, host cell infection, antibiotic stress) can suggest conditions where the protein plays important roles.

  • Proteomic Approaches:

    • Co-immunoprecipitation followed by mass spectrometry to identify protein-protein interactions

    • Protein microarrays to detect binding partners

    • Post-translational modification analysis to identify regulatory mechanisms

  • Structural Biology: X-ray crystallography, cryo-EM, or NMR spectroscopy to determine three-dimensional structure, which can suggest functional motifs similar to those found in proteins with known functions .

  • Genetic Manipulation:

    • Gene knockout/knockdown studies to observe phenotypic changes

    • Complementation experiments with mutated versions to identify critical residues

    • Overexpression studies to observe gain-of-function effects

  • Biochemical Assays: Systematic testing of potential enzymatic activities based on structural predictions or homology to characterized proteins.

  • Heterologous Expression: Expression in non-pathogenic mycobacteria like M. smegmatis to observe effects on host interactions, similar to studies done with Rv2231c .

These approaches should be applied iteratively, with results from one method informing the design of subsequent experiments.

How does Rv2237/MT2296 compare to other characterized mycobacterial proteins in terms of potential functional significance?

While specific comparative data for Rv2237/MT2296 is limited, insights can be drawn from studies on other mycobacterial proteins, particularly those initially designated as "uncharacterized." Many proteins in M. tuberculosis exhibit "moonlighting" functions, serving multiple roles depending on cellular context and infection stage.

For example, Rv2231c (a different mycobacterial protein) was initially classified as a histidinol phosphate aminotransferase involved in histidine biosynthesis, but has subsequently been shown to play crucial roles in host-pathogen interactions by:

  • Modulating host immune responses through TLR4 receptor engagement

  • Suppressing pro-inflammatory cytokines (TNF, IL-12, IL-6)

  • Inhibiting expression of co-stimulatory molecules (CD80, CD86) and MHC-I

  • Promoting M2 macrophage polarization

  • Inhibiting apoptosis in macrophages

This pattern of multifunctionality is common among mycobacterial proteins, suggesting that Rv2237/MT2296 may similarly possess functions beyond its primary metabolic role. Understanding these multiple roles requires examination in both in vitro biochemical systems and in the context of host-pathogen interactions.

What computational approaches can assist in predicting the function of Rv2237/MT2296?

Modern computational biology offers several approaches to predict protein function:

  • Sequence-Based Analysis:

    • BLAST and PSI-BLAST searches for homologous proteins with known functions

    • Motif scanning using databases like PROSITE, PFAM, and InterPro

    • Conservation analysis across mycobacterial species

  • Structure-Based Predictions:

    • Homology modeling using templates from structurally similar proteins

    • Ab initio structure prediction using tools like AlphaFold2

    • Virtual screening for potential binding partners or substrates

    • Active site prediction and comparison with known enzyme families

  • Network-Based Approaches:

    • Gene co-expression network analysis

    • Protein-protein interaction (PPI) network integration

    • Metabolic pathway mapping and gap-filling analyses

  • Machine Learning Methods:

    • Supervised learning models trained on characterized proteins

    • Bayesian methods for protein function prediction, similar to those implemented for analyzing protein-protein interactions

    • Deep learning approaches utilizing multiple data types

  • Phylogenetic Profiling:

    • Identifying proteins with similar evolutionary patterns across species

    • Co-evolution analysis to detect functionally linked proteins

These computational predictions provide testable hypotheses that should be validated through experimental approaches. The integration of predictions from multiple methods typically yields more reliable functional predictions than any single approach.

What are the recommended protocols for studying protein-protein interactions involving Rv2237/MT2296?

Several complementary techniques are recommended for comprehensive characterization of protein-protein interactions:

  • MicroScale Thermophoresis (MST):

    • Particularly useful for quantifying binding affinities

    • Requires fluorescent labeling of one interaction partner

    • Can detect interactions in near-native conditions with minimal sample consumption

    • Bayesian analysis approaches can be applied to MST data for more robust quantification of affinity parameters

  • Co-Immunoprecipitation (Co-IP) followed by Mass Spectrometry:

    • Allows discovery of novel interaction partners from cell lysates

    • Requires antibodies against Rv2237/MT2296 or its epitope tag

    • Follow with Western blotting for verification of specific interactions

    • Appropriate controls for non-specific binding are essential

  • Yeast Two-Hybrid (Y2H) Screening:

    • Useful for systematic screening of interaction partners

    • Construction of bait (Rv2237/MT2296) and prey (potential interactors) plasmids

    • False positives should be verified with alternative methods

  • Surface Plasmon Resonance (SPR):

    • Provides real-time kinetic data on association/dissociation rates

    • Requires immobilization of one protein partner on sensor chip

    • Can determine equilibrium dissociation constants (KD values)

  • Biolayer Interferometry (BLI):

    • Alternative to SPR with simpler experimental setup

    • Provides similar kinetic information about binding interactions

  • Protein Complementation Assays:

    • Split reporter systems (e.g., split-GFP, split-luciferase)

    • Useful for monitoring interactions in living cells

    • Can be adapted for high-throughput screening

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps interaction interfaces at peptide resolution

    • Provides insights into conformational changes upon binding

Combining multiple techniques provides more reliable results than any single method. Initial screening methods (Y2H, Co-IP/MS) can be followed by quantitative methods (MST, SPR) for detailed characterization of specific interactions.

What are the optimal storage and handling conditions for maintaining the stability and activity of recombinant Rv2237/MT2296?

Proper storage and handling are crucial for maintaining protein integrity and activity:

  • Long-term Storage:

    • Store lyophilized protein at -20°C to -80°C

    • Reconstituted protein should be stored with 5-50% glycerol (recommended final concentration: 50%) at -20°C to -80°C

    • Aliquot to avoid repeated freeze-thaw cycles

  • Short-term Storage:

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles, which can cause protein denaturation

  • Reconstitution Protocol:

    • Briefly centrifuge vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Allow complete dissolution before use

  • Buffer Considerations:

    • The protein is supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • This formulation enhances stability during lyophilization and storage

  • Quality Control:

    • Verify protein integrity by SDS-PAGE before experimental use

    • Consider activity assays once the protein's function is established

    • For tagged proteins, confirm tag accessibility if it will be used for detection or purification

  • Handling Precautions:

    • Minimize exposure to extreme temperatures or pH conditions

    • Avoid unnecessary exposure to oxidizing agents

    • Use sterile technique when handling reconstituted protein to prevent microbial contamination

These guidelines ensure maximal retention of protein structure and activity for experimental applications.

How can researchers verify the proper folding and activity of recombinant Rv2237/MT2296?

Verifying proper protein folding and activity is essential, particularly for uncharacterized proteins where specific activity assays may not be established:

  • Biophysical Characterization:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to examine tertiary structure (intrinsic tryptophan fluorescence)

    • Dynamic Light Scattering (DLS) to detect aggregation

    • Thermal shift assays to evaluate thermal stability and proper folding

  • Structural Analysis:

    • Size Exclusion Chromatography (SEC) to verify monodispersity and expected molecular weight

    • Limited proteolysis to probe for well-folded domains resistant to digestion

    • NMR spectroscopy (1D proton NMR) to verify folded state through signal dispersion

  • Binding Assays:

    • Even without knowing specific function, test binding to general cofactors or substrates based on structural predictions

    • Surface Plasmon Resonance (SPR) or MicroScale Thermophoresis (MST) to evaluate binding to predicted interaction partners

  • Functional Predictions and Testing:

    • Based on sequence and structural homology, design experiments to test predicted activities

    • If enzymatic activity is suspected, screen against substrate libraries

    • For proteins potentially involved in signaling, test phosphorylation state or other post-translational modifications

  • Cellular Assays:

    • Expression in heterologous systems (e.g., M. smegmatis) to observe phenotypic effects

    • Complementation of knockout strains to verify functional activity

    • Localization studies to confirm proper subcellular targeting

Given the uncharacterized nature of Rv2237/MT2296, these approaches provide a systematic framework for validating protein quality before proceeding to more detailed functional studies.

How might understanding Rv2237/MT2296 contribute to tuberculosis treatment strategies?

Understanding the function of Rv2237/MT2296 could significantly impact TB treatment approaches in several ways:

  • Novel Drug Target Identification:

    • If Rv2237/MT2296 proves essential for M. tuberculosis survival or virulence, it could represent a novel drug target

    • Proteins unique to mycobacteria with no human homologs are particularly valuable targets for selective inhibition

    • Structure-based drug design could be employed once the protein's structure and function are determined

  • Biomarker Development:

    • If the protein is secreted or expressed during specific phases of infection, it could serve as a diagnostic biomarker

    • Expression patterns during different disease stages might provide insights into disease progression

  • Understanding Pathogenesis Mechanisms:

    • Similar to Rv2231c, Rv2237/MT2296 may be involved in host-pathogen interactions that modulate immune responses

    • Such insights could reveal new immunomodulatory approaches to TB treatment

  • Vaccine Development:

    • If the protein elicits protective immune responses, it could be evaluated as a component of subunit vaccines

    • Understanding its role in immunomodulation could inform adjuvant development for TB vaccines

  • Persistence and Dormancy:

    • Many uncharacterized proteins in M. tuberculosis play roles in adaptation to stress conditions and dormancy

    • If Rv2237/MT2296 contributes to bacterial persistence, it could help address the challenge of latent TB infection

  • Systems Biology Integration:

    • Placing Rv2237/MT2296 within metabolic networks could reveal vulnerable nodes for multi-target therapeutic approaches

    • Network analysis may uncover synergistic drug combinations that include inhibitors of this protein's function

The significant challenges of TB treatment—particularly drug resistance, treatment duration, and latent infection—necessitate novel approaches based on deeper understanding of mycobacterial biology. Functional characterization of uncharacterized proteins represents an important frontier in this effort.

What challenges exist in translating basic research on proteins like Rv2237/MT2296 into clinical applications?

Translating basic research findings on mycobacterial proteins into clinical applications faces several significant challenges:

Addressing these challenges requires integrated approaches that span basic science, translational research, clinical development, and implementation science. Collaborative efforts between academic institutions, industry partners, and public health agencies are essential for successful translation of basic discoveries into clinical impact.

What are the most promising research directions for elucidating the function of Rv2237/MT2296?

Based on current knowledge and methodological capabilities, several research directions hold particular promise:

  • Integrated Structural and Functional Genomics:

    • Determine the three-dimensional structure through X-ray crystallography or cryo-EM

    • Compare structural features with proteins of known function

    • Identify potential active sites or binding pockets for functional hypothesis generation

  • Systems Biology Approaches:

    • Integrate transcriptomic, proteomic, and metabolomic data to place Rv2237/MT2296 in cellular networks

    • Analyze expression patterns during different growth phases and stress conditions

    • Examine co-expression patterns with proteins of known function

  • Host-Pathogen Interaction Studies:

    • Investigate whether Rv2237/MT2296, like Rv2231c, interacts with host immune components

    • Assess impact on macrophage responses and cytokine production

    • Evaluate contribution to bacterial survival in host cells

  • Genetic Manipulation with Precise Phenotyping:

    • Generate conditional knockdowns to assess essentiality under various conditions

    • Create point mutations in predicted functional residues to correlate structure with function

    • Employ CRISPRi for temporal control of expression to identify stage-specific roles

  • Comparative Analysis Across Mycobacterial Species:

    • Examine conservation and divergence across pathogenic and non-pathogenic mycobacteria

    • Correlate sequence/structural differences with pathogenicity

    • Perform complementation studies across species to assess functional conservation

  • High-Resolution Interactome Mapping:

    • Apply proximity labeling approaches (BioID, APEX) to identify interaction partners in native conditions

    • Use crosslinking mass spectrometry to define interaction interfaces

    • Integrate with structural data to build comprehensive interaction models

  • Translational Research Applications:

    • Assess immunogenicity and potential as diagnostic biomarker

    • Evaluate as a potential drug target through in silico screening and experimental validation

    • Investigate contribution to antibiotic tolerance or resistance mechanisms

These approaches, particularly when applied in combination, offer the most promising path to elucidating the function of this uncharacterized protein and understanding its significance in mycobacterial biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.