Recombinant Uncharacterized protein Rv2273/MT2334 (Rv2273, MT2334)

Shipped with Ice Packs
In Stock

Description

Expression and Purification Systems

For research and commercial purposes, Rv2273/MT2334 can be produced as a recombinant protein in various expression systems. While Escherichia coli remains the most commonly used host for efficient production , multiple expression platforms have been developed to accommodate different research requirements, as detailed in Table 1.

Table 1. Expression Systems for Recombinant Rv2273/MT2334 Production

Expression SystemHost Strains/Cell LinesTag OptionsAdvantages
ProkaryoticBL21(DE3), JM115, Rosetta-GAMIHis, FLAG, MBP, GST, trxA, NusHigh yield, cost-effective, rapid expression
YeastSMD1168, GS115, X-33Various fusion tagsPost-translational modifications, proper folding
Insect CellSf 9, Sf 21, Sf High FiveHis, GST, othersComplex eukaryotic processing capabilities
Mammalian293, 293T, NIH/3T3, COS-7, CHOMultiple tag optionsNative-like modifications, complex folding

The choice of expression system significantly impacts protein yield, purity, and biological activity. His-tagged versions are particularly common due to the ease of purification using immobilized metal affinity chromatography (IMAC).

Genomic Context

Rv2273/MT2334 is categorized in the "Cell wall and cell processes" functional class within the M. tuberculosis genome annotation system . This classification suggests potential involvement in maintaining cell envelope integrity, cell wall synthesis, transport processes, or signaling pathways associated with the bacterial membrane. The gene's context within the genome and its conservation pattern across mycobacterial species further support its functional importance.

Predicted Biological Functions

While the specific cellular role of Rv2273/MT2334 remains to be fully characterized, its transmembrane nature and classification provide some insights into its potential functions. Transmembrane proteins in pathogenic bacteria frequently serve crucial roles in:

  1. Nutrient acquisition and transport across the cell membrane

  2. Environmental sensing and signal transduction

  3. Cell wall biogenesis and remodeling

  4. Host-pathogen interactions and virulence

  5. Stress response and adaptation to changing environments

The identification of Rv2273 as a differentially expressed gene under specific conditions suggests it may contribute to M. tuberculosis adaptability to environmental stressors or host-derived challenges during infection .

Transcriptional Profiling Studies

Gene expression analyses have revealed that Rv2273/MT2334 can be upregulated under specific experimental conditions. A transcriptional profiling study of M. tuberculosis reported a 2.00-fold increase in Rv2273 expression with a standard deviation of 1.2 when the bacterium was exposed to certain environmental stimuli . This upregulation occurred alongside several other transmembrane and cell wall-associated proteins, suggesting a coordinated response to the tested conditions.

Table 2. Upregulated Transmembrane Proteins in M. tuberculosis Under Specific Conditions

Gene DesignationDescriptionFold ChangeStandard Deviation
MT2334 (Rv2273)Probable conserved transmembrane protein2.001.2
MT0409 (Rv0399c)Putative lipoprotein lpqK2.370.5
MT2339 (Rv2281)Putative phosphate permease pitB3.591.5
MT3080 (Rv3000)Possible conserved transmembrane protein3.111.4
MT1297 (Rv1258c)Putative Tap-like membrane efflux pump5.940.3
MT2016 (Rv1964)Membrane protein yrbE3A2.051.3
MT0961 (Rv0934)Periplasmic phosphate-binding lipoprotein pstS11.900.8

Cloning and Expression Studies

Previous research has demonstrated successful cloning and expression of numerous M. tuberculosis membrane proteins, including those with similar properties to Rv2273/MT2334. These studies have established protocols for efficient production of mycobacterial membrane proteins in heterologous expression systems . Such approaches provide valuable tools for further investigation of Rv2273's structural features and functional properties.

Tuberculosis Research

As a component of the M. tuberculosis cell envelope, Rv2273/MT2334 represents a potential target for understanding bacterial physiology and pathogenesis. The availability of the recombinant protein enables several research avenues:

  1. Investigation of M. tuberculosis membrane organization and dynamics

  2. Identification of interaction partners through pull-down assays or protein-protein interaction studies

  3. Analysis of the protein's role in bacterial survival under stress conditions

  4. Examination of potential involvement in drug resistance mechanisms

  5. Assessment of immunogenicity and potential as a vaccine candidate

Future Research Directions

Several promising research avenues could enhance our understanding of Rv2273/MT2334:

  1. Comprehensive structural characterization to determine its three-dimensional conformation and membrane topology

  2. Gene knockout or knockdown studies to assess its essentiality and phenotypic consequences

  3. Transcriptomic and proteomic analyses under various growth conditions to identify regulatory networks

  4. Investigation of post-translational modifications that might modulate its function

  5. Comparative studies across mycobacterial species to understand evolutionary conservation

  6. Exploration of potential interactions with host factors during infection

  7. Assessment of its utility as a biomarker or drug target for tuberculosis management

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Target Names
Rv2273, MT2334
Target Protein Sequence
MNRHSTAASDRGLQAERTTLAWTRTAFALLVNGVLLTLKDTQGADGPAGLIPAGLAGAAA SCCYVIALQRQRALSHRPLPARITPRGQVHILATAVLVLMVVTAFAQLL
Uniprot No.

Q&A

What is Recombinant Uncharacterized protein Rv2273/MT2334?

Recombinant Uncharacterized protein Rv2273/MT2334 is a full-length protein (109 amino acids) identified in the human proteome with the UniProt ID P64971. While classified as uncharacterized, researchers typically produce it recombinantly with tags (such as His-tag) to facilitate purification and characterization studies. The protein's complete amino acid sequence is: MNRHSTAASDRGLQAERTTLAWTRTAFALLVNGVLLTLKDTQGADGPAGLIPAGLAGAAASCCYVIALQRQRALSHRPLPARITPRGQVHILATAVLVLMVVTAFAQLL .

The recombinant version is commonly expressed in bacterial systems like E. coli, resulting in a stable protein that can be used for structural, functional, and interaction studies. While its physiological role remains undefined, its study continues to be important for completing our understanding of the human proteome.

What expression systems are recommended for producing this protein?

While mammalian expression systems like HEK293 cells can be used for producing human recombinant proteins (especially those requiring post-translational modifications), E. coli remains the preferred expression system for Rv2273/MT2334 . The methodology involves:

  • Cloning the coding sequence into an appropriate expression vector containing a His-tag sequence

  • Transforming the vector into competent E. coli cells

  • Inducing expression using IPTG or similar inducer

  • Harvesting cells and lysing them to release the recombinant protein

  • Purifying using affinity chromatography methods

For researchers concerned with specific research applications, the bacterial expression system offers advantages of high yield, cost-effectiveness, and simplified purification protocols, particularly important when working with smaller proteins like Rv2273/MT2334 (109 amino acids) .

How should the recombinant protein be stored and reconstituted?

The recombinant Rv2273/MT2334 protein is typically supplied as a lyophilized powder and requires proper handling to maintain stability and functionality. The recommended storage and reconstitution protocol is:

ParameterRecommendation
Storage temperatureStore at -20°C/-80°C upon receipt
AliquotingNecessary for multiple use
Reconstitution mediumDeionized sterile water
Recommended concentration0.1-1.0 mg/mL
Storage additive5-50% glycerol (final concentration)
Short-term storageWorking aliquots at 4°C for up to one week
Freeze-thaw cyclesAvoid repeated freeze-thaw cycles

The protein should be centrifuged briefly before opening to bring contents to the bottom of the vial. After reconstitution, adding glycerol (typically to 50% final concentration) helps maintain stability during freezing . For optimal results, researchers should prepare single-use aliquots to minimize protein degradation from repeated freeze-thaw cycles.

What purification strategies yield highest purity for Rv2273/MT2334?

Purification of Rv2273/MT2334 typically employs a multi-step chromatographic approach similar to methodologies used for other recombinant proteins. Based on optimized protocols for recombinant protein production, a comprehensive purification strategy would include:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA columns to capture the His-tagged protein

  • Intermediate Purification: Ion exchange chromatography using Q-Sepharose columns (particularly effective for separating the target protein from host cell proteins)

  • Polishing Step: Size exclusion chromatography using an FPLC system for final purification and buffer exchange

This systematic approach typically yields protein with purity greater than 90% as determined by SDS-PAGE . For researchers requiring ultra-high purity (>95%), additional optimization steps may include:

  • Adjusting buffer composition during each purification step

  • Implementing a stepwise elution gradient during ion-exchange chromatography

  • Incorporating hydrophobic interaction chromatography as an orthogonal purification step

Optimization of buffer conditions (pH, salt concentration, additives) for each specific step significantly impacts final purity and yield, requiring empirical determination for this specific protein .

How can researchers verify the structural integrity of purified Rv2273/MT2334?

Assessment of structural integrity is crucial for ensuring the biological relevance of subsequent experiments. A comprehensive characterization approach would include:

  • Primary Structure Verification:

    • Mass spectrometry (MS) to confirm molecular weight

    • Peptide mapping after enzymatic digestion

    • N-terminal sequencing to verify the correct start of the protein

  • Secondary/Tertiary Structure Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Fluorescence spectroscopy to examine tertiary structure

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Functional Verification:

    • Binding assays with potential interaction partners

    • Activity assays (if the function becomes characterized)

Each analytical technique provides complementary information, and researchers should select methods based on their specific research questions and available instrumentation .

What experimental approaches can elucidate the function of this uncharacterized protein?

Determining the function of uncharacterized proteins like Rv2273/MT2334 requires a multi-faceted approach:

  • Computational Prediction:

    • Sequence homology searches against characterized proteins

    • Structural modeling and comparison with proteins of known function

    • Analysis of conserved domains and motifs

  • Molecular Interaction Studies:

    • Pull-down assays using the recombinant protein as bait

    • Yeast two-hybrid screening to identify interaction partners

    • Protein microarrays to screen for binding partners

  • Cellular Localization:

    • Immunofluorescence using antibodies raised against the recombinant protein

    • Subcellular fractionation followed by Western blotting

    • Expression of GFP-tagged protein for live-cell imaging

  • Functional Genomics:

    • RNA interference or CRISPR-Cas9 knockout studies to observe phenotypic effects

    • Overexpression studies to identify gain-of-function phenotypes

    • Transcriptomic analysis to identify gene expression changes

The integration of these approaches, coupled with careful data analysis, maximizes the likelihood of functional annotation .

How can researchers address solubility issues with Rv2273/MT2334?

Recombinant proteins often present solubility challenges during expression and purification. For Rv2273/MT2334, optimization strategies include:

  • Expression Conditions Optimization:

    • Testing different induction temperatures (16°C, 25°C, 37°C)

    • Varying inducer concentration and induction duration

    • Using specialized E. coli strains designed for difficult-to-express proteins

  • Buffer Optimization:

    • Screening various pH conditions (typically pH 6.0-8.5)

    • Testing different salt concentrations (100-500 mM NaCl)

    • Adding solubility enhancers (glycerol, arginine, trehalose)

  • Tag Selection:

    • While His-tag is commonly used , alternative tags (MBP, GST, SUMO) may enhance solubility

    • Evaluating N-terminal versus C-terminal tag placement

When encountering aggregation during reconstitution, researchers should consider:

  • Reconstituting at lower concentrations (0.1-0.5 mg/mL)

  • Adding non-ionic detergents at concentrations below their critical micelle concentration

  • Using specialized refolding protocols if the protein forms inclusion bodies

What are the critical quality control parameters for Rv2273/MT2334 preparations?

Ensuring consistent quality of recombinant protein preparations is essential for reproducible research. Key quality control parameters include:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE with densitometry>90%
IdentityWestern blot with anti-His antibodySingle band at expected MW
Endotoxin contentLAL assay<1 EU/mg protein
Aggregation stateDynamic light scatteringPrimarily monodisperse
Functional activityApplication-specific assaysTo be determined based on function

Researchers should establish appropriate specifications based on their experimental requirements and document batch-to-batch consistency using a combination of these analytical methods .

How can Rv2273/MT2334 be utilized in structural biology studies?

Structural characterization of Rv2273/MT2334 can provide insights into its potential function. Recommended approaches include:

  • X-ray Crystallography:

    • High-throughput crystallization screening to identify suitable conditions

    • Optimization of crystal growth for high-resolution diffraction

    • Structure determination and refinement

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Isotopic labeling (15N, 13C) during recombinant expression

    • Multidimensional NMR experiments for structure determination

    • Analysis of protein dynamics and interactions

  • Cryo-Electron Microscopy:

    • Particularly valuable if the protein forms larger complexes

    • Sample preparation optimization on various grid types

    • Data collection and processing for 3D reconstruction

For successful structural studies, researchers should focus on producing highly homogeneous protein preparations, exploring various buffer conditions to enhance stability, and considering the addition of potential binding partners to stabilize relevant conformations .

What strategies can detect post-translational modifications in Rv2273/MT2334?

Although Rv2273/MT2334 expressed in E. coli will lack eukaryotic post-translational modifications (PTMs), researchers investigating potential natural PTMs should consider:

  • Mass Spectrometry-Based Approaches:

    • Bottom-up proteomics with enrichment strategies for specific PTMs

    • Top-down proteomics for intact protein analysis

    • Targeted multiple reaction monitoring for quantitative analysis

  • Expression in Eukaryotic Systems:

    • Comparison of E. coli-expressed versus mammalian cell-expressed protein

    • Use of HEK293 cells for expression with natural modification machinery

    • Analysis of differences in electrophoretic mobility or peptide mapping

  • Specific PTM Detection Methods:

    • Phosphorylation: Pro-Q Diamond staining, phospho-specific antibodies

    • Glycosylation: Periodic acid-Schiff staining, lectin blotting

    • Ubiquitination: Western blotting with anti-ubiquitin antibodies

Researchers should employ multiple complementary techniques to comprehensively characterize PTMs and consider their functional significance in regulatory pathways .

What are the future research directions for Rv2273/MT2334?

Understanding uncharacterized proteins represents an important frontier in proteomics research. For Rv2273/MT2334, promising research avenues include:

  • Integrative Structural Biology:

    • Combining multiple structural techniques for comprehensive characterization

    • Computational modeling to predict functional sites and potential binding partners

    • Structure-based virtual screening to identify interacting molecules

  • Systems Biology Approaches:

    • Network analysis to place the protein in relevant biological pathways

    • Multi-omics integration to correlate expression with other cellular changes

    • Development of bioinformatics tools specifically for uncharacterized protein annotation

  • Translational Research Potential:

    • Investigation of potential roles in health and disease states

    • Development of specific antibodies or molecular probes

    • Evaluation as a potential biomarker or therapeutic target

The methodical investigation of uncharacterized proteins like Rv2273/MT2334 continues to expand our understanding of cellular processes and may reveal novel biological mechanisms with significant implications for basic and applied research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.