Recombinant Uncharacterized protein Rv2293c/MT2350 (Rv2293c, MT2350)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Uncharacterized protein Rv2293c/MT2350 (Rv2293c, MT2350) is a protein that Creative BioMart offers for life science research . The protein's precise function and characteristics are not well-defined, hence the term "uncharacterized" .

Properties

PropertyDescription
Full NameUncharacterized Protein Rv2293c/Mt2350(Rv2293c, Mt2350)
TagHis-Tagged
Source (Host)E. coli
SpeciesHuman
Protein LengthFull Length of Mature Protein (25-246)

Function

The uncharacterized protein Rv2293c/MT2350 is involved in several pathways and possesses multiple biochemical functions . This protein interacts directly with other proteins and molecules, as detected through methods like yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays .

M23 Endopeptidases in Mycobacterium tuberculosis

M23 endopeptidases are versatile enzymes required for the growth and virulence of pathogenic bacteria, but remain largely unexplored in M. tuberculosis . Studies have investigated the function of Rv0950c, a previously uncharacterized gene, demonstrating its role in regulating cell length and peptidoglycan remodeling in M. tuberculosis . Bioinformatics and phylogenetic analyses suggest that Rv0950c is highly conserved in structure but functionally divergent from non-mycobacterial M23 endopeptidases .

Role in Peptidoglycan Metabolism

Bacterial peptidoglycan (PG) metabolism is crucial for survival and pathogenesis, necessitating further exploration of the roles of Rv0950c and other putative M23 endopeptidases in M. tuberculosis . Loss of Rv0950 leads to a reduction in cell length and changes in the uptake of fluorescent D-amino acids (FDAAs) in response to cell wall damage .

Applications of Full-Length Proteins

Recombinant full-length proteins like Rv2293c/MT2350 can be used in:

  • Drug development to study drug-target protein interactions, understand binding mechanisms, and evaluate drug activity and specificity .

  • Cell therapy to prepare therapeutic cell products, such as receptor proteins in CAR-T cell therapy for tumor immunotherapy .

  • Vaccine development to prepare antigens that induce an immune response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-246
Protein Length
Full Length of Mature Protein
Target Names
Rv2293c, MT2350
Target Protein Sequence
DPGYVANVIPCEQRTLVLSAFPAEADAVLAHTALDANPVVVADRRRYYLGSISGKKVIVA MTGIGLVNATNTTETAFARFTCASSIAIAAVMFSGVAGGAGRTSIGDVAIPARWTLDNGA TFRGVDPGMLATAQTLSVVLDNINTLGNPVCLCRNVPVVRLNHLGRQPQLFVGGDGSSSD KNNGQAFPCIPNGGSVFAANPVVHPIAHLAIPVTFSRRRDPG
Uniprot No.

Q&A

What expression systems are recommended for producing Rv2293c/MT2350 protein?

When expressing Rv2293c/MT2350, consider the following methodological approach:

  • E. coli Expression System: Most commonly used for initial expression trials due to its simplicity and high yield potential. The protein has been successfully expressed in E. coli with His-tagging .

  • Expression Optimization Protocol:

    • Clone the gene into a vector with an N-terminal His-tag

    • Transform into BL21(DE3) or Rosetta(DE3) E. coli strains

    • Test expression at different temperatures (16°C, 25°C, 37°C)

    • Optimize induction conditions (IPTG concentration: 0.1-1.0 mM)

    • Evaluate solubility in different buffer conditions

  • Alternative Systems: If E. coli expression yields insoluble protein, consider:

    • Mycobacterium smegmatis expression system for better folding of mycobacterial proteins

    • Insect cell expression systems for improved solubility

Purification should employ a two-step approach combining IMAC (immobilized metal affinity chromatography) followed by size exclusion chromatography to achieve >95% purity .

What initial assays should be performed to begin characterizing the function of Rv2293c/MT2350?

As an uncharacterized protein, a systematic approach to functional characterization should include:

  • Bioinformatic Analysis:

    • Sequence-based homology searches using BLAST, HHpred

    • Domain prediction using InterPro, SMART

    • Structural homology modeling using I-TASSER or AlphaFold2

    • Genomic context analysis to identify potential operons

  • Biochemical Characterization:

    • Thermal shift assays to identify potential ligands

    • Enzymatic activity screens using generic substrates for common enzymatic classes

    • Protein-protein interaction studies using pull-down assays

    • Crystallization trials for structural determination

  • Cellular Localization:

    • Generation of GFP-fusion constructs

    • Immunofluorescence with anti-His antibodies

    • Subcellular fractionation of mycobacterial cells

For initial screening, focus on protein-protein interactions with known Mtb virulence factors, as similar uncharacterized proteins like Rv2346c have been shown to interact with host immune signaling pathways .

How can I design RNA interference experiments to study the function of Rv2293c/MT2350?

When designing RNA interference experiments for Rv2293c/MT2350 functional studies:

  • Target Sequence Selection:

    • Design 3-5 different siRNA or shRNA sequences targeting different regions of Rv2293c

    • Avoid sequences with homology to other M. tuberculosis genes

    • Select sequences with 40-60% GC content

    • Use validated algorithms (e.g., siDirect, IDT design tool) to minimize off-target effects

  • Delivery Methods for Mycobacteria:

    • For M. tuberculosis, antisense RNA approaches may be more effective than classic RNAi

    • Consider CRISPR interference (CRISPRi) with catalytically dead Cas9 for gene knockdown

    • Utilize mycobacteriophage-based delivery systems

  • Validation Protocol:

    • Confirm knockdown efficiency using RT-qPCR (>70% reduction in transcript)

    • Verify protein reduction via Western blot

    • Include scrambled RNA controls

    • Test multiple knockdown constructs to rule out off-target effects

  • Phenotypic Assessment:

    • Growth curve analysis under different stress conditions

    • Macrophage infection models with knockdown strains

    • Transcriptional profiling of knockdown strains

This approach parallels methods used in studies of other M. tuberculosis proteins like Rv1495, where protein-specific interactions were characterized through targeted genetic approaches .

How can protein-protein interaction networks be established for Rv2293c/MT2350?

For comprehensive protein-protein interaction (PPI) mapping of Rv2293c/MT2350:

  • In Vitro PPI Screening:

    • Bacterial two-hybrid system adapted for mycobacterial proteins

    • Pull-down assays using His-tagged Rv2293c/MT2350 as bait

    • Surface plasmon resonance (SPR) with immobilized Rv2293c/MT2350

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

  • In Vivo Approaches:

    • Proximity-dependent biotin identification (BioID) with Rv2293c/MT2350-BirA* fusion

    • APEX2-based proximity labeling in mycobacterial cells

    • Co-immunoprecipitation from M. tuberculosis lysates

    • Cross-linking mass spectrometry (XL-MS)

  • Validation Protocol:

    • Confirm direct interactions using recombinant proteins

    • Map interaction domains through truncation analysis

    • Assess functional relevance through co-localization studies

    • Perform competition assays with predicted binding partners

  • Data Analysis Framework:

    • Use CytoScape for network visualization

    • Employ GO term enrichment analysis for functional clustering

    • Compare with known interactomes of related proteins (e.g., Rv1495-TopA interaction networks)

This methodology follows established protocols that have successfully identified functional interactions for other M. tuberculosis proteins, such as the MazF protein Rv1495 and DNA topoisomerase I .

What approaches can be used to determine if Rv2293c/MT2350 plays a role in M. tuberculosis virulence?

To investigate the potential virulence role of Rv2293c/MT2350:

  • Gene Knockout/Knockdown Studies:

    • Generate precise gene deletion mutants using specialized transduction

    • Create conditional expression strains using tetracycline-inducible systems

    • Implement CRISPR-Cas9 gene editing for marker-free mutations

    • Measure growth rates in standard media and under stress conditions

  • Infection Models:

    • Human macrophage infection assays with wildtype vs. mutant strains

    • THP-1 cell infection model with cytokine profiling

    • Mouse infection models with bacterial burden quantification

    • Measure TNF-α and IL-6 production as indicators of immune response

  • Transcriptional Response Analysis:

    • RNA-seq of host cells infected with wildtype vs. mutant strains

    • ChIP-seq to identify potential DNA binding sites if DNA-binding is predicted

    • RT-qPCR validation of key differentially expressed genes

    • Pathway analysis of altered host responses

  • Experimental Design Matrix:

Experimental ApproachControl GroupExperimental GroupKey Readouts
Macrophage InfectionWT M.tb strainΔRv2293c strainBacterial survival, Cytokine production, Host gene expression
Mouse InfectionWT M.tb strainΔRv2293c strainBacterial load, Lung pathology, Survival time
ComplementationΔRv2293c strainΔRv2293c + Rv2293cRestoration of phenotype

These methods parallel successful approaches used for characterizing Rv2346c, which was found to enhance mycobacterial survival by modulating TNF-α and IL-6 production through the p38/miRNA/NF-κB pathway .

What are the best methods for crystallizing Rv2293c/MT2350 for structural determination?

For successful crystallization of Rv2293c/MT2350:

  • Protein Preparation Optimization:

    • Express with removable tags (His-tag with TEV protease site)

    • Perform buffer optimization using thermal shift assays

    • Use size exclusion chromatography to ensure monodispersity

    • Concentrate to 5-15 mg/mL depending on solubility properties

  • Crystallization Screening Strategy:

    • Initial broad screening using commercial sparse matrix screens

    • Implement sitting-drop vapor diffusion at multiple temperatures (4°C, 18°C)

    • Test protein:precipitant ratios of 1:1, 1:2, and 2:1

    • Consider surface entropy reduction mutations if initial screens fail

  • Optimization Protocol:

    • Fine-grid screening around promising conditions

    • Additive screening to improve crystal quality

    • Seeding techniques for reproducible crystal growth

    • In situ proteolysis for flexible regions

  • Alternate Approaches:

    • Co-crystallization with potential binding partners or substrates

    • Consider lipidic cubic phase (LCP) crystallization if membrane-associated

    • Explore nanobody-assisted crystallization for challenging proteins

    • If crystallization proves difficult, pursue cryo-EM as an alternative

For proteins like Rv2293c where function is unknown, a ligand screening approach may identify stabilizing compounds that facilitate crystallization, similar to approaches used for other challenging M. tuberculosis proteins .

How can molecular dynamics simulations provide insights into Rv2293c/MT2350 function?

Molecular dynamics (MD) simulations offer powerful insights for uncharacterized proteins:

  • Simulation Setup Protocol:

    • Generate initial structure using AlphaFold2 or homology modeling

    • Set up system in explicit solvent using AMBER, GROMACS, or NAMD

    • Use appropriate force fields (AMBER ff14SB, CHARMM36)

    • Perform energy minimization followed by equilibration

    • Run production simulations for at least 100-500 ns

  • Analysis Framework:

    • Calculate RMSD and RMSF to assess structural stability

    • Identify potential binding pockets using tools like MDpocket

    • Analyze electrostatic surface potential for functional clues

    • Perform principal component analysis to identify major conformational changes

  • Advanced Simulation Approaches:

    • Accelerated MD or Gaussian accelerated MD for enhanced sampling

    • Replica exchange simulations to explore conformational space

    • Steered MD to investigate potential substrate pathways

    • Virtual screening against identified binding pockets

  • Integration with Experimental Data:

    • Validate simulation findings with mutagenesis experiments

    • Use simulation-derived hypotheses to guide biochemical assays

    • Employ MD to interpret mass spectrometry or HDX-MS data

This methodology follows approaches used in successful structure-based studies of other M. tuberculosis proteins, as demonstrated in the identification of inhibitors of SARS-CoV-2 3CL-PRO through virtual screening and molecular dynamics simulation .

How can I design optimal experimental approaches for testing multiple hypotheses about Rv2293c/MT2350 function?

For systematic hypothesis testing of Rv2293c/MT2350 function:

  • Structured Hypothesis Development:

    • Generate hypotheses based on:

      • Structural predictions and domain analysis

      • Genomic context and potential operon partners

      • Expression patterns during infection stages

      • Homology to proteins of known function

  • Bayesian Experimental Design Approach:

    • Implement information-theoretic metrics to prioritize experiments

    • Use mutual information and submodularity principles to optimize experimental selection

    • Design correction functions to account for model misspecification

    • Employ time-dependent experimental design to adapt based on results

  • Parallel Testing Framework:

    • Design modular assays that can test multiple functions simultaneously

    • Implement multiplexed readouts for efficient data collection

    • Consider factorial experimental designs to identify interaction effects

    • Use adaptive sampling to focus resources on promising hypotheses

  • Integrative Data Analysis:

    • Combine results from diverse experimental modalities

    • Implement Bayesian network analysis to identify causal relationships

    • Use machine learning approaches to identify patterns across datasets

    • Develop quantitative models to predict protein function

This methodological framework aligns with advanced experimental design principles described in patent US11017316B2, which outlines optimal experimental design based on mutual information and submodularity .

What controls and validation steps are essential when working with Rv2293c/MT2350 in macrophage infection models?

When utilizing macrophage infection models to study Rv2293c/MT2350:

  • Essential Controls:

    • Wild-type M. tuberculosis strain (positive control)

    • Complemented ΔRv2293c strain (restoration control)

    • Known attenuated strain (e.g., H37Ra) (attenuation control)

    • Uninfected macrophages (negative control)

    • Isogenic strain with mutation in an unrelated gene (specificity control)

  • Validation Protocol:

    • Confirm gene deletion/expression by RT-qPCR and Western blot

    • Verify growth rates in axenic culture before infection

    • Standardize infection protocol with consistent MOI (multiplicity of infection)

    • Implement time-course analysis with multiple timepoints (2, 24, 48, 72, 96 hours)

  • Readout Methodology Matrix:

ReadoutMethodPurposeValidation Approach
Bacterial SurvivalCFU countingQuantify intracellular replicationCompare to microscopy-based methods
Cytokine ProductionELISA, multiplex assaysMeasure immune responseValidate key findings with RT-qPCR
Phagosome MaturationConfocal microscopyAssess bacterial compartmentalizationUse multiple markers (LAMP1, Rab7, Cathepsin D)
Macrophage ViabilityFlow cytometryDetermine cytotoxicityConfirm with LDH release assay
  • Advanced Validation Techniques:

    • siRNA knockdown of host factors to validate interaction pathways

    • Single-cell analysis to assess population heterogeneity

    • Live cell imaging to track infection dynamics

    • Correlative light and electron microscopy for ultrastructural analysis

These approaches are based on protocols established for other M. tuberculosis virulence factors, such as Rv2346c, which has been shown to enhance mycobacterial survival by modulating host cytokine responses .

How can in vitro findings about Rv2293c/MT2350 be validated in more physiologically relevant models?

To translate in vitro findings to physiologically relevant systems:

  • Progressive Model Complexity:

    • Start with primary human macrophages rather than cell lines

    • Advance to 3D cell culture systems (spheroids, organoids)

    • Implement perfusion systems to mimic in vivo conditions

    • Utilize ex vivo infected human lung tissue models

  • Advanced Tissue Systems:

    • Lung-on-a-chip microfluidic devices

    • Human lung organoids with multiple cell types

    • Co-culture systems with immune cells

    • Biomechanically accurate culture systems that reproduce the mechanical and electrical environment of cells

  • Transition to Animal Models:

    • C57BL/6 mouse infection model (standard model)

    • Guinea pig model (forms granulomas similar to humans)

    • Non-human primate models for closest human relevance

    • Implement reporter strains for in vivo tracking

  • Validation Framework:

    • Confirm protein expression in animal models

    • Verify phenotypes observed in vitro

    • Analyze tissue-specific effects

    • Measure immune response parameters consistent with in vitro studies

This approach bridges the gap between in vitro and in vivo research by reproducing the mechanical and electrical environment of cells in controlled in vitro settings, as described in innovative research tools that address the weaknesses of traditional in vitro experiments .

What methodologies can detect potential post-translational modifications of Rv2293c/MT2350 in host-pathogen contexts?

For comprehensive analysis of post-translational modifications (PTMs) of Rv2293c/MT2350:

  • Mass Spectrometry-Based Approaches:

    • Immunoprecipitate tagged Rv2293c/MT2350 from infected cells

    • Perform in-gel digestion with multiple proteases for optimal coverage

    • Apply advanced MS techniques:

      • Middle-down proteomics for larger peptide fragments

      • Electron transfer dissociation (ETD) for labile modifications

      • Parallel reaction monitoring (PRM) for targeted PTM analysis

    • Implement enrichment strategies for specific PTMs (phospho-enrichment, etc.)

  • Site-Directed Mutagenesis Validation:

    • Mutate predicted modification sites to non-modifiable residues

    • Create phosphomimetic mutations (S/T to D/E) to simulate phosphorylation

    • Test functional consequences in bacterial survival assays

    • Compare wildtype and mutant protein localization

  • Temporal Dynamics Assessment:

    • Analyze PTM status across infection timeline

    • Monitor changes under different stress conditions

    • Correlate modifications with virulence phenotypes

    • Identify host enzymes responsible for modifications

  • Host-Pathogen PTM Networks:

    • Map kinase/phosphatase networks potentially targeting bacterial proteins

    • Identify ubiquitination machinery interactions

    • Study acetylation/deacetylation dynamics

    • Investigate potential crosstalk between different modification types

This comprehensive approach mirrors studies of other M. tuberculosis virulence factors where PTMs critically regulate function, such as the phosphorylation-dependent activity observed in the p38/miRNA/NF-κB pathway modulated by Rv2346c .

How can multi-omics data be integrated to understand the role of Rv2293c/MT2350 in M. tuberculosis biology?

For comprehensive multi-omics integration:

  • Data Collection Strategy:

    • Transcriptomics: RNA-seq of WT vs. ΔRv2293c strains under multiple conditions

    • Proteomics: Global and phosphoproteomics analysis

    • Metabolomics: Targeted and untargeted profiling

    • Interactomics: AP-MS or BioID for protein interaction networks

  • Integration Framework:

    • Implement multi-layered network analysis

    • Use Bayesian data integration approaches

    • Apply machine learning for pattern recognition across datasets

    • Develop causal inference models to identify regulatory relationships

  • Functional Validation Pipeline:

    • Prioritize findings through network centrality measures

    • Validate key nodes through targeted genetic manipulation

    • Perform targeted metabolite supplementation experiments

    • Develop reporter systems for pathway activation

  • Systems-Level Analysis Matrix:

Integration LevelMethodsExpected InsightsValidation Approach
Gene-ProteinCorrelation analysis, causality modelsExpression-translation relationshipsWestern blot, proteomics
Protein-MetaboliteEnzyme-substrate predictions, flux analysisMetabolic impactsMetabolite supplementation
Regulatory NetworksMaster regulator analysis, TF binding predictionTranscriptional control mechanismsChIP-seq, reporter assays
Host-Pathogen InterfaceInterspecies network analysisInfection impact pointsCo-immunoprecipitation, infection models

This systems biology approach has been successfully applied to other M. tuberculosis proteins, revealing complex pathway interactions similar to those observed with Rv2346c's modulation of host immune responses .

What bioinformatic approaches can predict potential binding partners or substrates for Rv2293c/MT2350?

For computational prediction of Rv2293c/MT2350 binding partners:

  • Sequence-Based Approaches:

    • Conserved domain analysis for functional prediction

    • Coevolution analysis using direct coupling analysis (DCA)

    • Short linear motif (SLiM) identification for protein-protein interactions

    • Genomic context and neighborhood analysis

  • Structure-Based Methods:

    • Protein-protein docking with M. tuberculosis proteome

    • Binding site prediction using cavity detection algorithms

    • Molecular dynamics simulations to identify stable binding modes

    • Fragment-based virtual screening for potential ligands

  • Systems-Level Predictions:

    • Network-based function prediction using guilt-by-association

    • Shared expression pattern analysis across conditions

    • Phylogenetic profiling to identify functionally related proteins

    • Literature-based knowledge discovery using natural language processing

  • Validation Strategy:

    • Prioritize predictions based on confidence scores

    • Perform targeted pull-down assays for top candidates

    • Use surface plasmon resonance (SPR) for binding confirmation

    • Implement FRET-based assays for interaction verification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.