Recombinant Uncharacterized protein Rv2307c/MT2364 (Rv2307c, MT2364)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on your purchase method and location. For accurate delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Avoid repeated freezing and thawing. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. The default glycerol concentration for our products is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To prevent degradation, minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While we prioritize determining tag type during production, we are open to fulfilling requests for specific tags. Please communicate your preferred tag type, and we will strive to accommodate it during the manufacturing process.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Target Names
Rv2307c, MT2364
Target Protein Sequence
MSLKRCRALPVVAIVALVASGVIMFIWSQQRRLIYFPSAGPVPSASSVLPAGRDVVVETQ DGMRLGGWYFPHTSGGSGPAVLVCNGNAGDRSMRAELAVALHGLGLSVLLFDYRGYGGNP GRPSEQGLAADARAAQEWLSGQSDVDPARIAYFGESLGAAVAVGLAVQRPPAALVLRSPF TSLAEVGAVHYPWLPLRRLLLDHYPSIERIASVHAPVLVIAGGSDDIVPATLSERLVAAA AEPKRYVVVPGVGHNDPELLDGRVMLDAIRRFLTETAVLGQ
Uniprot No.

Q&A

What is Rv2307c/MT2364 and what organism does it originate from?

Rv2307c/MT2364 is an uncharacterized protein from Mycobacterium tuberculosis, the causative agent of tuberculosis. The designation "Rv2307c" refers to the gene locus in the reference strain H37Rv genome, while "MT2364" refers to the corresponding gene in clinical isolates. The protein is currently classified as "uncharacterized" because its precise biological function remains undetermined despite the complete sequencing of the M. tuberculosis genome. The protein consists of 281 amino acids and is available as a recombinant full-length protein with a histidine tag when expressed in E. coli expression systems . Understanding this protein's function may provide insights into M. tuberculosis pathogenesis and potentially reveal new drug targets for tuberculosis treatment.

What are the fundamental properties of Rv2307c/MT2364?

Rv2307c/MT2364 is a protein of 281 amino acids with a molecular weight of approximately 30-32 kDa (depending on the presence of tags and expression conditions). The protein's basic properties include:

PropertyCharacteristicMethod of Determination
Length281 amino acidsGene sequence analysis
Expression systemE. coliRecombinant technology
Tags availableHis-tagAffinity purification
SolubilityModerateExpression optimization
StabilitypH-dependentBuffer optimization

The protein's isoelectric point, hydrophobicity profile, and secondary structure predictions can be generated using bioinformatics tools, though experimental validation is essential for confirming these properties. Since the protein remains uncharacterized, researchers should begin with basic biochemical characterization before proceeding to more complex functional studies .

Why are uncharacterized proteins like Rv2307c/MT2364 important research targets?

Uncharacterized proteins like Rv2307c/MT2364 represent significant research opportunities for several reasons:

First, these proteins may perform novel or essential functions in pathogenic organisms like M. tuberculosis, potentially serving as targets for therapeutic intervention. Approximately 25-40% of microbial genomes encode proteins of unknown function, creating a substantial knowledge gap in our understanding of pathogen biology.

Second, characterizing these proteins may reveal previously undescribed biochemical pathways or cellular processes that enhance our fundamental understanding of bacterial physiology. For M. tuberculosis specifically, understanding non-obvious gene functions may explain its remarkable ability to persist in host tissues and develop antibiotic resistance.

Third, studying uncharacterized proteins often leads to the development of new experimental methods and analytical approaches that benefit broader research communities. The methodological challenges presented by proteins like Rv2307c/MT2364 drive innovation in structural biology, functional genomics, and systems biology approaches.

Finally, comparative genomics analyses suggest conservation of certain uncharacterized proteins across mycobacterial species, indicating potential evolutionary significance that warrants investigation .

What expression systems and conditions are optimal for Rv2307c/MT2364 production?

For successful expression and purification of Rv2307c/MT2364, researchers should consider the following methodological approaches:

ParameterRecommended ConditionsRationale
E. coli strainBL21(DE3) or RosettaEnhanced expression of mycobacterial proteins
Expression vectorpET series with T7 promoterTight regulation and high expression
Induction0.1-0.5 mM IPTG at OD600 0.6-0.8Prevents inclusion body formation
Temperature16-18°C post-inductionPromotes proper folding
Duration16-20 hoursMaximizes yield while maintaining quality
MediaLB or TB with appropriate antibioticsProvides necessary nutrients

Alternative expression systems worth considering include:

  • Mycobacterium smegmatis for more native-like post-translational modifications

  • Cell-free protein synthesis for difficult-to-express variants

  • Insect cell systems for complex eukaryotic studies

Each system requires specific optimization, and researchers should conduct small-scale expression trials before scaling up. Solubility screening using different buffer compositions (varying pH, salt concentration, and additives like glycerol) is crucial for determining optimal purification conditions.

What experimental approaches should be employed to determine the function of Rv2307c/MT2364?

Determining the function of uncharacterized proteins like Rv2307c/MT2364 requires a multi-faceted approach combining biochemical, structural, and genetic methodologies:

Sequence-Based Analysis:
Begin with comprehensive bioinformatics analysis using tools like BLAST, Pfam, and HMMER to identify conserved domains, motifs, or homology to proteins with known functions. Even low sequence similarity may provide initial functional hypotheses.

Structural Studies:
Determine the three-dimensional structure using X-ray crystallography, NMR spectroscopy, or cryo-EM. Structural information can reveal potential active sites, binding pockets, or structural similarities to characterized proteins. For Rv2307c/MT2364, crystallization trials should explore conditions at pH 6.0-8.0 with various precipitants and additives.

Interactome Analysis:
Identify protein-protein interactions using techniques such as:

  • Bacterial two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID)

  • Crosslinking mass spectrometry (XL-MS)

Interaction partners often provide valuable clues about functional context.

Genetic Approaches:

  • Create knockout/knockdown strains in M. tuberculosis or surrogate mycobacterial hosts

  • Perform phenotypic profiling under various stress conditions

  • Conduct complementation studies

  • Employ CRISPR interference for conditional depletion

Biochemical Characterization:

  • Enzymatic activity screening using substrate panels

  • Binding assays with potential ligands identified through computational predictions

  • Post-translational modification analysis

Transcriptional Profiling:
Analyze expression patterns under different conditions to identify regulatory networks and potential stress responses associated with Rv2307c/MT2364.

Integration of these approaches provides the most comprehensive path toward functional characterization, with each method compensating for limitations in others .

How can researchers analyze contradictory data regarding Rv2307c/MT2364 function?

When confronted with contradictory data regarding Rv2307c/MT2364 function, researchers should implement a systematic approach to resolve discrepancies:

1. Methodological Comparison:
Create a detailed comparison table of experimental conditions across contradictory studies:

ParameterStudy 1Study 2Study 3Potential Impact
Expression systemE. coliM. smegmatisHEK293Folding, PTMs
Protein constructFull-lengthTruncatedDomain-specificActivity, solubility
Buffer conditionspH 7.4, 150mM NaClpH 6.5, 100mM NaClpH 8.0, 200mM NaClConformational state
Assay temperature25°C37°C30°CEnzyme kinetics
Assay componentsWith Mg²⁺With Mn²⁺Metal-freeCatalytic requirements

2. Validation with Orthogonal Methods:
Confirm key findings using alternative techniques that rely on different principles. For example, if a protein interaction is detected by two-hybrid screening but not by co-immunoprecipitation, validate using a third method like surface plasmon resonance or microscale thermophoresis.

3. Biological Context Consideration:
Evaluate whether contradictions might reflect genuine biological differences:

  • Growth phase-dependent functions

  • Strain-specific variations

  • Context-dependent activities

  • Moonlighting functions in different cellular compartments

4. Technical Artifact Assessment:
Systematically rule out technical issues:

  • Reagent contamination

  • Non-specific binding

  • Improper controls

  • Batch effects

  • Statistical limitations

5. Collaborative Resolution:
Consider establishing collaborations with laboratories reporting contradictory results to perform side-by-side experiments under identical conditions with exchanged materials.

6. Computational Integration:
Apply Bayesian statistical frameworks to weight evidence based on methodological rigor and reproducibility, potentially revealing which results are more likely to represent biological reality.

For uncharacterized proteins like Rv2307c/MT2364, contradictory data often reflects the genuine complexity of multifunctional proteins rather than experimental error. Therefore, comprehensive documentation and transparent reporting of all conditions are essential for the research community's collective progress .

What structural analysis techniques are most appropriate for Rv2307c/MT2364 characterization?

Structural characterization of Rv2307c/MT2364 requires a strategic combination of techniques to overcome challenges associated with uncharacterized proteins:

X-ray Crystallography:
The gold standard for high-resolution structures, but crystallization of uncharacterized proteins often proves challenging. For Rv2307c/MT2364:

  • Implement sparse matrix screening with 500+ conditions

  • Explore fusion partners (e.g., T4 lysozyme, BRIL) to enhance crystallizability

  • Test surface entropy reduction mutations to promote crystal contacts

  • Consider crystallization with potential binding partners or substrate analogs

Nuclear Magnetic Resonance (NMR) Spectroscopy:
Particularly valuable for dynamic regions and ligand binding studies:

  • Begin with 1D ¹H-NMR to assess sample quality

  • Progress to 2D ¹⁵N-HSQC to evaluate protein folding

  • For full structure determination, produce doubly (¹³C/¹⁵N) or triply (¹³C/¹⁵N/²H) labeled protein

  • Consider selective labeling strategies to focus on specific regions

Cryo-Electron Microscopy (cryo-EM):
Increasingly powerful for proteins resistant to crystallization:

  • Most effective if Rv2307c/MT2364 forms oligomers or complexes >100 kDa

  • Single-particle analysis may reveal conformational ensembles

  • Negative staining EM provides a rapid assessment of sample quality

Small-Angle X-ray Scattering (SAXS):
Valuable for solution-state structural analysis:

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
Provides insights into protein dynamics and ligand interactions:

  • Maps solvent-accessible regions

  • Identifies conformational changes upon binding

  • Reveals allosteric networks

Integrated Structural Biology Approach:
Combining multiple techniques provides comprehensive structural characterization:

For Rv2307c/MT2364, computational structure prediction using AlphaFold2 or RoseTTAFold should also be performed to generate initial models that can guide experimental design and interpretation .

How should researchers design experiments to identify interacting partners of Rv2307c/MT2364?

Identifying interaction partners of uncharacterized proteins like Rv2307c/MT2364 requires a multi-tiered experimental approach:

1. Affinity Purification-Mass Spectrometry (AP-MS):

  • Express Rv2307c/MT2364 with an affinity tag (His-tag is already available)

  • Perform pull-down experiments using mycobacterial lysates or reconstituted systems

  • Analyze co-purifying proteins by mass spectrometry

  • Implement label-free quantification to distinguish specific from non-specific interactions

  • Include appropriate controls:

    • Tag-only expression construct

    • Unrelated protein with same tag

    • Competitive elution conditions

2. Proximity-Dependent Labeling:

  • Generate fusion constructs of Rv2307c/MT2364 with BioID, TurboID, or APEX2

  • Express in mycobacterial systems or surrogate hosts

  • Induce proximity labeling and purify biotinylated proteins

  • Identify labeled proteins using mass spectrometry

  • Advantages: Captures transient interactions and spatial proteomics information

3. Yeast Two-Hybrid or Bacterial Two-Hybrid Screening:

  • Create bait constructs with Rv2307c/MT2364

  • Screen against M. tuberculosis genomic libraries

  • Validate positive interactions with secondary assays

  • Consider split-protein complementation assays for in vivo validation

4. Protein Microarrays:

  • Probe M. tuberculosis proteome arrays with purified Rv2307c/MT2364

  • Alternatively, immobilize Rv2307c/MT2364 and probe with fractionated cellular extracts

  • Detect interactions using labeled antibodies or direct protein labeling

5. Crosslinking Mass Spectrometry (XL-MS):

  • Apply chemical crosslinkers to stabilize protein complexes

  • Identify crosslinked peptides by specialized MS workflows

  • Provides spatial constraints for structural modeling

  • Particularly useful for transient interactions

6. Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

  • Immobilize purified Rv2307c/MT2364

  • Screen potential interactors identified by other methods

  • Determine binding kinetics and affinity constants

  • Establish binding hierarchies and competition patterns

7. Co-crystallization:

  • Attempt to co-crystallize Rv2307c/MT2364 with putative partners

  • Provides atomic-level details of interaction interfaces

Experimental Design Considerations:

MethodAdvantagesLimitationsBest For
AP-MSComprehensive, physiological contextBackground binding, requires effective antibodiesGlobal interactome mapping
Proximity labelingCaptures transient interactions, in vivoPotential off-target labeling, requires genetic manipulationSpatial interactome mapping
Y2H/B2HHigh-throughput, binary interactionsFalse positives/negatives, artificial environmentInitial screening
Protein arraysHigh-throughput, direct bindingNon-physiological conditions, recombinant proteinsRapid screening
XL-MSStructural information, stabilizes transient interactionsComplex data analysis, crosslinker accessibilityStructural interactomics
SPR/BLIQuantitative binding parametersOne-to-one analysis, requires purified componentsValidation and characterization
Co-crystallizationAtomic resolution of interfacesTechnically challenging, may alter natural interactionsDetailed mechanism studies

For uncharacterized proteins like Rv2307c/MT2364, it is crucial to implement at least three complementary approaches and establish stringent validation criteria to minimize false discoveries .

What are the optimal purification strategies for recombinant Rv2307c/MT2364?

Purifying recombinant Rv2307c/MT2364 requires a tailored approach to address the challenges of uncharacterized proteins. Based on the available information about its His-tagged expression in E. coli , the following purification strategy is recommended:

Step 1: Lysis and Initial Clarification

  • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 5% glycerol, 1 mM PMSF, protease inhibitor cocktail

  • Lysis method: Sonication (6 cycles of 30s on/30s off) or high-pressure homogenization (15,000-20,000 psi)

  • Clarification: Centrifugation at 20,000 × g for 45 minutes at 4°C

  • Optional: Include 0.1% Triton X-100 in lysis buffer if initial solubility is poor

Step 2: Immobilized Metal Affinity Chromatography (IMAC)

  • Resin: Ni-NTA or TALON (cobalt-based) agarose

  • Loading: Apply clarified lysate at flow rate of 1 mL/min

  • Washing:

    • Wash 1: Lysis buffer with 20 mM imidazole (10 column volumes)

    • Wash 2: Lysis buffer with 40 mM imidazole (5 column volumes)

  • Elution: Step gradient with 100, 200, and 300 mM imidazole

  • Analysis: SDS-PAGE of fractions to identify target protein (expected MW ~32 kDa with His-tag)

Step 3: Secondary Purification

  • Size Exclusion Chromatography (SEC):

    • Column: Superdex 75 or Superdex 200

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT

    • Flow rate: 0.5 mL/min

    • Collect 0.5-1 mL fractions and analyze by SDS-PAGE

Alternative/Additional Steps:

  • Ion Exchange Chromatography (IEX): If isoelectric point allows separation from contaminants

  • Hydrophobic Interaction Chromatography (HIC): Particularly useful if Rv2307c/MT2364 has hydrophobic patches

  • Affinity Tag Removal: Consider TEV protease cleavage if tag-free protein is required

Optimization Table for Challenging Purifications:

ChallengeRecommended ModificationRationale
Poor solubilityAdd 0.5M arginine or 1M urea to buffersSuppresses aggregation without denaturation
Protein instabilityInclude 10% glycerol and 5 mM 2-mercaptoethanolStabilizes structure and prevents oxidation
Co-purifying contaminantsAdd 0.1% Triton X-100 in lysis onlyReduces non-specific binding
Proteolytic degradationIncrease EDTA to 5 mM in buffers after IMACInhibits metal-dependent proteases
Aggregation during concentrationLimit concentration to <5 mg/mL, add 100 mM L-argininePrevents concentration-dependent aggregation
Precipitation during storageStore at moderate concentration with 50% glycerol at -20°CPrevents freeze-thaw damage

Quality Control:

  • Purity assessment: SDS-PAGE (>95% purity) and mass spectrometry

  • Homogeneity evaluation: Dynamic light scattering (DLS)

  • Structural integrity: Circular dichroism (CD) spectroscopy

  • Activity verification: Develop based on predicted function

The final purified Rv2307c/MT2364 should be aliquoted, flash-frozen in liquid nitrogen, and stored at -80°C to maximize stability and minimize freeze-thaw cycles .

What analytical techniques should be used to assess the quality of purified Rv2307c/MT2364?

Thorough quality assessment of purified Rv2307c/MT2364 is essential before proceeding with functional or structural studies. A comprehensive analytical workflow should include:

1. Purity and Identity Assessment:

  • SDS-PAGE Analysis:

    • Use 12% or 15% gels for optimal resolution

    • Stain with Coomassie Blue (detection limit ~0.1 μg)

    • Silver staining for higher sensitivity (detection limit ~1 ng)

    • Densitometry analysis to quantify purity (target >95%)

  • Western Blotting:

    • Anti-His antibody detection to confirm identity

    • Consider generating specific antibodies against Rv2307c/MT2364 peptides

  • Mass Spectrometry:

    • Intact mass analysis to confirm molecular weight (expected ~32 kDa with His-tag)

    • Peptide mass fingerprinting after tryptic digestion for sequence coverage

    • Top-down MS for post-translational modification mapping

2. Homogeneity Analysis:

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determines absolute molecular weight independent of shape

    • Detects oligomeric states and aggregation

    • Provides polydispersity index as a measure of sample homogeneity

  • Dynamic Light Scattering (DLS):

    • Rapid assessment of size distribution

    • Monitors temperature-dependent aggregation

    • Screens buffer conditions for optimal stability

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments for determining homogeneity

    • Sedimentation equilibrium for accurate molecular weight and oligomeric state

3. Structural Integrity Evaluation:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV (190-250 nm) for secondary structure content

    • Near-UV (250-350 nm) for tertiary structure fingerprint

    • Thermal melting experiments for stability assessment

  • Differential Scanning Fluorimetry (DSF/Thermofluor):

    • Determines thermal stability (Tm)

    • Screens for stabilizing buffer conditions

    • Identifies potential ligands that increase thermal stability

  • 1D NMR Spectroscopy:

    • ¹H-NMR provides spectral fingerprint of folded state

    • Evaluates sample homogeneity and protein folding

4. Functional Integrity Tests:

  • Activity Assays:

    • Develop based on bioinformatic predictions or homology

    • Consider general assays for common enzymatic activities

  • Ligand Binding Analysis:

    • Microscale Thermophoresis (MST) to detect binding of predicted ligands

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Surface Plasmon Resonance (SPR) for binding kinetics

5. Long-term Stability Assessment:

  • Storage Stability Tests:

    • Regular analysis of samples stored under different conditions

    • Monitoring by SDS-PAGE, DLS, and activity assays over time

Quality Assessment Checklist:

Analytical ParameterMethodAcceptance CriteriaTroubleshooting if Failed
PuritySDS-PAGE/Densitometry>95%Additional purification step
IdentityMS/Western blotMatches predicted MWConfirm construct sequence
MonodispersityDLSPDI <0.2Optimize buffer or filtration
Oligomeric stateSEC-MALSConsistent with predictionBuffer optimization
Secondary structureCD spectroscopyStable spectrumRefold or buffer screen
Thermal stabilityDSFSingle transition, Tm >40°CAdditives or buffer optimization
Functional activityAssay-dependentReproducible, concentration-dependentProtein engineering or refolding

For uncharacterized proteins like Rv2307c/MT2364, it's particularly important to establish multiple quality criteria since functional assays may not be immediately available. The analytical data collected should be thoroughly documented to establish batch-to-batch consistency and reproducibility .

What computational approaches can predict potential functions of Rv2307c/MT2364?

Computational prediction of Rv2307c/MT2364 function requires integrating multiple bioinformatic approaches to generate testable hypotheses. Given its uncharacterized status , the following methodological framework is recommended:

1. Sequence-Based Function Prediction:

  • Homology-Based Methods:

    • BLAST/PSI-BLAST against reference databases (UniProt, RefSeq)

    • Search for remote homologs using HHpred (Hidden Markov Model comparison)

    • Consider position-specific scoring matrices for distant relationships

    • Analyze multiple sequence alignments for conserved residues

  • Motif and Domain Analysis:

    • Scan against Pfam, PROSITE, and InterPro databases

    • Identify conserved sequence motifs and functional domains

    • Even partial matches may suggest functional categories

  • Genomic Context Analysis:

    • Examine neighboring genes in M. tuberculosis genome

    • Identify operonic arrangements suggesting functional relationships

    • Compare genomic neighborhoods across mycobacterial species

    • Apply guilt-by-association principles for co-regulated genes

2. Structure-Based Function Prediction:

  • 3D Structure Prediction:

    • Generate models using AlphaFold2, RoseTTAFold, or I-TASSER

    • Assess model quality using QMEAN, MolProbity scores

    • Compare predicted structures against PDB using DALI or VAST

  • Binding Site Prediction:

    • Identify potential active sites using CASTp or POCASA

    • Analyze electrostatic surface potential

    • Detect conserved spatial arrangements of catalytic residues

    • Predict binding pockets using SiteMap or FTMap

  • Molecular Docking:

    • Screen metabolite libraries against predicted binding sites

    • Consider mycobacterial-specific metabolites

    • Evaluate binding energies and interaction patterns

3. Systems Biology Approaches:

  • Co-expression Network Analysis:

    • Analyze transcriptomic datasets for genes co-expressed with Rv2307c

    • Construct gene co-expression networks

    • Identify functional modules containing Rv2307c/MT2364

  • Protein-Protein Interaction Prediction:

    • Use tools like STRING, STITCH, or PrePPI

    • Evaluate interaction confidence scores

    • Construct potential interaction networks

  • Pathway Enrichment Analysis:

    • Map predicted interactors to known biochemical pathways

    • Identify enriched functional categories

4. Integration and Hypothesis Generation:

MethodTools/DatabasesOutputConfidence Scoring
Sequence homologyBLAST, HHpredPotential homologsE-value, % identity
Domain predictionPfam, InterProFunctional domainsDomain score, coverage
Structural similarityDALI, TM-alignStructural homologsZ-score, TM-score
Binding site analysisCASTp, FTMapPotential ligandsConservation score, energy
Co-expressionSTRING, GeneMANIAFunctional associationsCorrelation coefficient
Integrated predictionSIFTER, COFACTORFunction probabilityLikelihood score

5. Validation Planning:
After computational analysis, design targeted experiments to test predictions:

  • Design site-directed mutagenesis of predicted catalytic residues

  • Test binding of predicted ligands using biophysical methods

  • Express in relevant biological contexts to observe phenotypes

Implementation Example:
For uncharacterized proteins like Rv2307c/MT2364, a hierarchical approach works best:

  • Start with rapid sequence analysis (BLAST, Pfam)

  • Follow with structural prediction and analysis

  • Contextualize findings with genomic and expression data

  • Integrate results to generate specific, testable hypotheses

  • Design targeted experiments to validate predictions

This computational framework enables researchers to narrow the functional search space for Rv2307c/MT2364, transforming an uncharacterized protein into a candidate with predicted functions that can be systematically tested .

How should researchers design gene knockout or knockdown experiments to study Rv2307c/MT2364 function in vivo?

Designing effective genetic manipulation experiments for Rv2307c/MT2364 requires careful consideration of mycobacterial biology and methodological limitations. The following comprehensive approach addresses key considerations for in vivo functional studies:

1. Knockout Strategy Selection:

  • Homologous Recombination-Based Deletion:

    • Design: Create a knockout construct with antibiotic resistance cassette flanked by 500-1000 bp homologous regions

    • Advantages: Complete gene removal, clean genetic background

    • Limitations: Low efficiency in mycobacteria, potential essentiality issues

    • Verification: PCR, Southern blotting, whole-genome sequencing

  • Specialized Transduction:

    • Design: Package knockout construct in temperature-sensitive mycobacteriophage

    • Advantages: Higher efficiency than plasmid-based methods

    • Verification: Similar to homologous recombination methods

  • CRISPR-Cas9 Genome Editing:

    • Design: Target PAM sites near gene termini, use templates for homology-directed repair

    • Advantages: Higher efficiency, multiplexing capability

    • Limitations: Off-target effects, PAM site requirements

    • Verification: Targeted sequencing, protein absence confirmation

2. Conditional Approaches for Essential Genes:

  • Tetracycline-Regulated Systems:

    • Design: Replace native promoter with tetracycline-inducible/repressible promoter

    • Advantages: Tunable expression, temporal control

    • Verification: RT-qPCR, western blot under inducing/repressing conditions

  • Degradation Tag Systems:

    • Design: Fuse protein with inducible degradation domain

    • Advantages: Post-translational control, rapid depletion

    • Verification: Western blot time course after induction

  • CRISPRi (CRISPR Interference):

    • Design: dCas9 targeting promoter or early coding sequence

    • Advantages: Tunable, reversible, works in mycobacteria

    • Verification: RT-qPCR, western blot

3. Complementation Studies:

  • Wild-type Complementation:

    • Design: Express wild-type gene from integrative or episomal vector

    • Purpose: Confirm phenotype is specific to target gene disruption

    • Controls: Empty vector, unrelated gene expression

  • Structure-Function Analysis:

    • Design: Express mutant versions targeting predicted functional sites

    • Purpose: Identify critical residues/domains

    • Controls: Wild-type complementation, expression-matched mutants

4. Experimental Design Table:

Experimental ApproachAdvantagesLimitationsVerification MethodsControls Required
Complete knockoutDefinitive loss of functionMay be lethal if essentialPCR, Southern blot, WGSWild-type strain, complemented strain
Conditional knockdownWorks for essential genesLeaky expressionRT-qPCR, western blotUninduced condition, non-target gene knockdown
CRISPRiTunable, multiplexableIncomplete repressionRT-qPCR, phenotypic assaysNon-targeting sgRNA, varying induction
ComplementationConfirms specificityExpression differencesRT-qPCR, western blotEmpty vector, unrelated protein
Point mutationsStructure-function insightsExpression variabilityWestern blot, activity assaysWild-type protein, stability controls

5. Phenotypic Analysis Framework:

  • Growth and Viability:

    • Growth curves in standard and stress conditions

    • Colony morphology assessment

    • Competitive growth with wild-type strain

  • Stress Response:

    • Antibiotic susceptibility profiling

    • Oxidative and nitrosative stress survival

    • Nutrient limitation tolerance

    • Acid stress response

  • Pathogenesis-Related:

    • Macrophage infection and survival

    • Animal model infection (if applicable)

    • Biofilm formation capability

    • Immune response modulation

  • Molecular Phenotyping:

    • Transcriptomics (RNA-seq)

    • Proteomics comparing mutant to wild-type

    • Metabolomics for pathway disruption

    • Lipidomics if membrane-related function suspected

6. Surrogate Host Considerations:

For challenging models like M. tuberculosis, consider:

  • M. smegmatis (fast-growing, non-pathogenic) for initial studies

  • M. bovis BCG (attenuated, similar physiology) for intermediate validation

  • M. marinum (pathogenic, more tractable) for infection models

7. Specialized Considerations for Rv2307c/MT2364:

Given the uncharacterized nature of Rv2307c/MT2364 , researchers should:

  • Begin with essentiality prediction using transposon mutagenesis databases

  • Consider conditional approaches first if essentiality is predicted

  • Design complementation constructs with different tags for localization studies

  • Prepare for unexpected phenotypes requiring broad screening approaches

This comprehensive framework ensures rigorous genetic analysis of Rv2307c/MT2364 function, with appropriate controls and validation steps to generate reliable insights into this uncharacterized protein's role in mycobacterial biology .

How should researchers interpret mass spectrometry data for post-translational modifications of Rv2307c/MT2364?

Interpreting mass spectrometry data for post-translational modifications (PTMs) of uncharacterized proteins like Rv2307c/MT2364 requires a systematic analytical workflow that addresses the unique challenges of mycobacterial proteins:

1. Sample Preparation Considerations:

  • Enrichment Strategies:

    • Phosphorylation: TiO₂, IMAC, or phospho-antibody enrichment

    • Glycosylation: Lectin affinity or hydrazide chemistry

    • Methylation/acetylation: Specific antibody immunoprecipitation

    • Lipidation: Click chemistry for myristoylation/palmitoylation

  • Protease Selection:

    • Primary digestion with trypsin (cleaves at K, R)

    • Complementary digestion with chymotrypsin or Glu-C

    • Consider limited proteolysis to improve coverage of hydrophobic regions

2. Mass Spectrometry Acquisition Strategy:

  • Instrumentation Selection:

    • High-resolution instruments (Orbitrap, Q-TOF) for accurate mass determination

    • Fragmentation methods: HCD for general PTMs, ETD for labile modifications

    • Data-dependent acquisition (DDA) for discovery

    • Parallel reaction monitoring (PRM) for targeted verification

  • Acquisition Parameters:

    • MS1 resolution: ≥60,000 at 400 m/z

    • MS2 resolution: ≥15,000 for PTM localization

    • NCE optimization for mycobacterial peptides (typically 28-32%)

    • Inclusion of neutral loss scans for phosphorylation

3. Data Analysis Workflow:

  • Database Search Parameters:

    • Search against M. tuberculosis proteome plus contaminants

    • Variable modifications to consider:

      • Phosphorylation (S, T, Y)

      • Acetylation (K, protein N-terminus)

      • Methylation (K, R)

      • Glycosylation (N, S, T)

      • Oxidation (M)

      • Mycobacteria-specific PTMs (e.g., ADP-ribosylation)

    • False discovery rate control: 1% at peptide and protein levels

  • PTM Localization Algorithms:

    • Utilize PTM score algorithms (Ascore, ptmRS, MD score)

    • Implement site localization probability cutoff (≥0.75)

    • Manual validation of MS/MS spectra for critical sites

4. Validation and Characterization:

  • Orthogonal Validation:

    • Site-directed mutagenesis of modified residues

    • Western blotting with modification-specific antibodies

    • Synthetic peptide standards with identical modifications

  • Functional Impact Assessment:

    • Structural mapping of PTM sites on AlphaFold2 model

    • Conservation analysis across mycobacterial homologs

    • Proximity to predicted functional sites or interfaces

5. Interpretation Framework:

PTM TypeDistribution PatternFunctional ImplicationValidation Approach
PhosphorylationRegions with disorder, loopsSignaling, regulationPhosphomimetic mutations
AcetylationSurface-exposed lysinesProtein-protein interaction, stabilityAcetylation-mimicking mutations
MethylationArginine-rich regionsProtein-RNA interactionMethyltransferase inhibitors
GlycosylationAsparagine in NXT/S motifsSecretion, host interactionGlycosidase treatment
ADP-ribosylationNear catalytic sitesEnzymatic regulationMutation of targeted residues

6. Analytical Challenges and Solutions:

  • Challenge: Low abundance of PTMs

    • Solution: Multi-stage enrichment, increased starting material

  • Challenge: Ambiguous site localization

    • Solution: Complementary fragmentation methods, synthetic standards

  • Challenge: Mycobacteria-specific modifications

    • Solution: Open search approaches, de novo sequencing

  • Challenge: Distinguishing biological PTMs from artifacts

    • Solution: Biological replicates, negative controls, metabolic labeling

7. Data Visualization and Reporting:

  • Create comprehensive PTM maps showing:

    • Modification sites with localization probabilities

    • Stoichiometry estimates where possible

    • Conservation across orthologs

    • Structural context within protein domains

For uncharacterized proteins like Rv2307c/MT2364, PTM analysis may provide the first clues to function, subcellular localization, or regulatory mechanisms. Given the 281-amino acid length of the protein , a comprehensive PTM analysis could reveal functional hotspots that guide subsequent biochemical characterization efforts.

What controls and validations are essential when performing protein-protein interaction studies with Rv2307c/MT2364?

Robust protein-protein interaction (PPI) studies for uncharacterized proteins like Rv2307c/MT2364 require comprehensive controls and validation strategies to distinguish genuine interactions from artifacts. The following framework ensures reliable identification and characterization of interaction partners:

1. Primary Detection Controls:

  • Negative Controls:

    • Tag-only expression constructs processed identically to Rv2307c/MT2364

    • Unrelated protein with same tag and similar size/properties

    • Empty vector controls for all expression systems

    • Non-specific IgG for immunoprecipitation experiments

    • Scrambled or non-targeting constructs for proximity labeling

  • Positive Controls:

    • Known interaction pairs from mycobacterial PPI databases

    • Engineered protein pairs with confirmed binding

    • Spiked-in standards for mass spectrometry quantification

  • Technical Replicates:

    • Minimum three biological replicates per condition

    • Technical replicates for mass spectrometry analysis

    • Independent experimental repetition with different protein preparations

2. Quantitative Filtering Criteria:

  • Statistical Analysis Framework:

    • Calculate fold-enrichment over background

    • Apply appropriate statistical tests (t-test, SAINT algorithm)

    • Implement false discovery rate control (typically 1-5%)

    • Set abundance ratio thresholds (typically >2-fold enrichment)

  • Visualization Methods:

    • Volcano plots of enrichment vs. statistical significance

    • Scatter plots comparing replicates and controls

    • Hierarchical clustering of interaction profiles

3. Orthogonal Validation Strategy:

Primary MethodValidation MethodSpecific ControlsSuccess Criteria
Affinity purification-MSCo-immunoprecipitationReciprocal pulldownEnrichment in both directions
Yeast two-hybridPull-down with purified proteinsDomain deletion constructsDirect binding confirmation
BioID proximity labelingFluorescence co-localizationCompartment markersSpatial correlation
Co-immunoprecipitationSurface plasmon resonanceConcentration seriesQuantifiable binding kinetics
Crosslinking-MSMutagenesis of interfaceStructure-guided mutationsAbolished or reduced interaction

4. Specificity Assessment:

  • Interaction Interface Mapping:

    • Domain deletion constructs to identify binding regions

    • Alanine scanning mutagenesis of predicted interfaces

    • Competition assays with peptides or domains

  • Physiological Relevance Evaluation:

    • Co-expression analysis in relevant conditions

    • Co-localization in native cellular context

    • Phenotypic correlation between interacting partners

5. Functional Validation:

  • Co-purification of Activity:

    • Activity assays with purified complexes

    • Reconstitution experiments with purified components

    • Enzymatic assays before and after complex formation

  • Genetic Correlation:

    • Epistasis analysis of gene knockouts/knockdowns

    • Phenotypic rescue experiments

    • Correlated evolutionary patterns (co-evolution analysis)

6. Structural Characterization:

  • Low-Resolution Methods:

    • Native gel electrophoresis for complex formation

    • Size exclusion chromatography with multi-angle light scattering

    • Negative-stain electron microscopy

  • High-Resolution Approaches:

    • X-ray crystallography of complexes

    • Cryo-EM structure determination

    • NMR titration experiments

7. Special Considerations for Rv2307c/MT2364:

Given its uncharacterized nature , researchers should implement:

  • Expression in mycobacterial hosts when possible

  • Careful evaluation of membrane association or localization

  • Comparison of interaction profiles under different growth conditions

  • Correlation with transcriptional responses in relevant stress conditions

8. Comprehensive Documentation Requirements:

  • Complete protein sequence including all tags

  • Expression conditions and cellular fractionation methods

  • Detailed purification and sample preparation protocols

  • Mass spectrometer parameters and search engine settings

  • All filtering criteria and statistical thresholds applied

  • Raw data availability in appropriate repositories (e.g., PRIDE)

By implementing this comprehensive control and validation framework, researchers can generate a high-confidence interaction network for Rv2307c/MT2364 that provides meaningful insights into its biological function and context within mycobacterial physiology .

What specialized reagents and resources are available for Rv2307c/MT2364 research?

1. Recombinant Protein Resources:

  • Commercial Sources:

    • Recombinant Full Length Uncharacterized Protein Rv2307C/Mt2364 with His-tag is available (Cat.# RFL28100HF)

    • Expression host: E. coli

    • Tag: His-tag

    • Length: Full length (1-281 amino acids)

  • Expression Plasmids:

    • Mycobacterial protein expression vectors (e.g., pMyNT, pET series)

    • Gateway-compatible entry clones from mycobacterial genome projects

    • Specialized vectors with inducible promoters for controlled expression

2. Genetic Tools and Constructs:

  • Knockout/Knockdown Resources:

    • Specialized transposon libraries for M. tuberculosis

    • CRISPRi systems adapted for mycobacteria

    • Conditional expression systems (tetracycline-regulated, degradation tag)

  • Reporter Constructs:

    • Promoter-reporter fusions for expression studies

    • Fluorescent protein fusions for localization

    • Split-reporter systems for protein-protein interactions

3. Antibodies and Detection Tools:

  • Antibodies:

    • Custom antibodies may need to be generated against Rv2307c/MT2364

    • Anti-His antibodies for recombinant protein detection

    • Consider generating peptide antibodies against unique regions

  • Detection Systems:

    • Epitope tagging strategies (FLAG, HA, myc) for tracking

    • Proximity labeling systems adapted for mycobacteria

    • Mass spectrometry-compatible tags for quantitative proteomics

4. Bioinformatic Resources:

Resource TypeSpecific Databases/ToolsApplication for Rv2307c/MT2364
Genome BrowsersTB Database, MycoBrowserGenomic context, expression data
Protein DatabasesUniProt, TBDB, PATRICAnnotation, conservation
Structure PredictionAlphaFold DB, SWISS-MODEL3D structure models
Functional PredictionInterPro, Pfam, KEGGDomain prediction, pathway context
Expression DataTBDB, GEO, SRACondition-specific expression
Essentiality DataDeJesus et al. datasets, TRANSITGenetic requirement predictions
Interaction NetworksSTRING, IntAct, TBDBPredicted functional associations

5. Experimental Systems:

  • Mycobacterial Strains:

    • M. tuberculosis H37Rv (reference strain)

    • Attenuated strains (H37Ra, M. bovis BCG) for BSL-2 work

    • M. smegmatis as a fast-growing surrogate host

    • Reporter strains for stress responses

  • Infection Models:

    • Macrophage infection systems (THP-1, RAW264.7, BMDMs)

    • Advanced 3D cell culture models

    • Animal models (mice, guinea pigs, non-human primates)

6. Specialized Methodologies:

  • Mycobacteria-Specific Protocols:

    • Optimized transformation methods for mycobacteria

    • Cell wall fractionation techniques

    • Specialized lysis procedures for efficient protein extraction

    • Adaptation of proximity labeling for mycobacterial physiology

  • Structural Biology Resources:

    • Specialized crystallization screens for mycobacterial proteins

    • NMR methods for membrane-associated proteins

    • Cryo-EM facilities for complex assemblies

7. Research Community and Collaborations:

  • Consortia and Networks:

    • TB Structural Genomics Consortium

    • Bill & Melinda Gates Foundation TB research networks

    • WHO TB research initiatives

  • Specialized Facilities:

    • BSL-3 laboratories for M. tuberculosis work

    • Core facilities with mycobacterial expertise

    • Structural biology centers with experience in challenging proteins

8. Unique Challenges and Solutions for Rv2307c/MT2364:

  • Challenge: Limited prior characterization

    • Solution: Leverage comparative genomics with related mycobacterial species

  • Challenge: Potential essentiality limiting genetic approaches

    • Solution: Implement conditional systems with tight regulation

  • Challenge: Potentially low expression levels

    • Solution: Codon optimization, fusion partners, specialized induction

  • Challenge: Function prediction difficulty

    • Solution: Multi-omics integration, phenotypic screening arrays

Given the uncharacterized nature of Rv2307c/MT2364 , researchers should consider establishing collaborations with laboratories specialized in mycobacterial protein characterization or structural biology to overcome technical challenges. Additionally, maintaining awareness of newly developed methodologies through conference participation and literature monitoring is essential in this rapidly evolving field.

What are the most significant challenges in characterizing Rv2307c/MT2364 and how can researchers overcome them?

Characterizing uncharacterized proteins like Rv2307c/MT2364 presents numerous technical and conceptual challenges. Understanding these challenges and implementing strategic solutions can accelerate functional discovery:

1. Expression and Purification Challenges:

  • Challenge: Poor solubility and yield

    • Solutions:

      • Explore fusion partners (MBP, SUMO, Trx) to enhance solubility

      • Test expression in mycobacterial hosts for native folding

      • Implement auto-induction media for gentler expression

      • Consider cell-free protein synthesis for toxic proteins

      • Design constructs based on predicted domains from AlphaFold2 models

  • Challenge: Protein instability during purification

    • Solutions:

      • Screen stabilizing buffer additives (arginine, proline, glycerol)

      • Implement thermal shift assays to identify stabilizing conditions

      • Consider on-column refolding protocols

      • Perform purification at reduced temperatures

      • Use protease inhibitor cocktails optimized for mycobacterial proteins

2. Functional Characterization Challenges:

  • Challenge: Absence of predicted domains or homology

    • Solutions:

      • Implement activity-based protein profiling

      • Screen diverse substrate libraries for enzymatic activity

      • Use metabolomics to identify changes in knockout/overexpression strains

      • Apply chemical biology approaches with activity-based probes

      • Consider untargeted co-factor identification by thermal proteome profiling

  • Challenge: Context-dependent function

    • Solutions:

      • Characterize under various stress conditions (hypoxia, starvation, acid)

      • Test function in different growth phases

      • Examine behavior during infection models

      • Consider protein-protein interactions under different conditions

3. Genetic Manipulation Challenges:

  • Challenge: Potential essentiality limiting knockout studies

    • Solutions:

      • Implement CRISPRi for partial depletion

      • Design conditional expression systems (tetracycline-regulated)

      • Use degradation tag systems for rapid protein depletion

      • Create hypomorphic alleles with reduced function

      • Consider specialized transposon mutagenesis approaches

  • Challenge: Compensation by paralogs or redundant pathways

    • Solutions:

      • Generate multiple knockouts of related genes

      • Implement synthetic genetic array analysis

      • Use chemical-genetic approaches to probe function

4. Structural Biology Challenges:

  • Challenge: Difficulty in obtaining crystals

    • Solutions:

      • Implement surface entropy reduction

      • Try in situ proteolysis during crystallization

      • Explore lipidic cubic phase for membrane-associated proteins

      • Consider nanobody or Fab fragment co-crystallization

      • Utilize cryo-EM for challenging targets

  • Challenge: Disordered regions hindering structural studies

    • Solutions:

      • Employ hydrogen-deuterium exchange mass spectrometry

      • Implement NMR for flexible regions

      • Design constructs removing disordered termini

      • Consider integrative structural biology approaches

5. Interactome Challenges:

  • Challenge: Transient or weak interactions

    • Solutions:

      • Apply chemical crosslinking before purification

      • Implement proximity labeling approaches (BioID, APEX)

      • Use membrane-based split-protein complementation assays

      • Consider time-resolved interaction studies

  • Challenge: Physiological relevance of detected interactions

    • Solutions:

      • Validate in mycobacterial systems

      • Confirm interaction under relevant stress conditions

      • Demonstrate co-localization in vivo

      • Show functional consequences of disrupting interaction

6. Strategic Approaches Table:

Challenge CategorySpecific ObstacleSolution StrategyResource Requirement
ExpressionLow solubilityFusion tags, specialized hostsMolecular biology expertise
PurificationInstabilityBuffer optimization, rapid processingProtein biochemistry capabilities
FunctionUnknown activityActivity-based profiling, untargeted screeningChemical biology infrastructure
Genetic analysisEssentialityConditional systems, partial depletionMycobacterial genetics expertise
StructureCrystallization difficultyAlternative methods (cryo-EM, NMR)Structural biology facilities
InteractionsWeak/transient bindingStabilization approaches, proximity labelingMass spectrometry access
Physiological contextCondition-specific functionMulti-condition testing, stress exposureBSL-3 capacity for M. tuberculosis

7. Integrated Workflow for Rv2307c/MT2364 Characterization:

Given the uncharacterized nature of Rv2307c/MT2364 , a systematic workflow should:

  • Begin with computational predictions to generate initial hypotheses

  • Prioritize protein production and basic biochemical characterization

  • Implement parallel approaches for functional screening

  • Develop condition-specific assays based on expression patterns

  • Integrate structural information as it becomes available

  • Establish genetic systems for in vivo validation

  • Contextualize findings within mycobacterial physiology

8. Specialized Considerations for Rv2307c/MT2364:

Based on its properties as a 281-amino acid protein from M. tuberculosis :

  • Consider potential involvement in stress responses common to mycobacteria

  • Evaluate subcellular localization as a key to function

  • Examine expression patterns during infection cycles

  • Investigate conservation patterns across pathogenic and non-pathogenic mycobacteria

By implementing these strategic approaches, researchers can overcome the significant challenges associated with characterizing uncharacterized proteins like Rv2307c/MT2364, ultimately contributing to our understanding of mycobacterial biology and potentially identifying new therapeutic targets for tuberculosis treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.