Recombinant Uncharacterized protein Rv2576c/MT2652 (Rv2576c, MT2652)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Protein Rv2576c/MT2652

The Recombinant Uncharacterized Protein Rv2576c/MT2652 is a protein derived from the bacterium Mycobacterium tuberculosis, specifically from the gene Rv2576c. This protein is of interest in scientific research due to its potential roles in various biological pathways and its possible involvement in the pathogenesis of tuberculosis. Despite its designation as "uncharacterized," significant research has been conducted to understand its functions and interactions.

Characteristics of Rv2576c/MT2652

  • Source and Host: The protein is typically expressed in Escherichia coli (E. coli) for research purposes, allowing for large-scale production and purification .

  • Protein Length and Sequence: The full-length protein consists of 154 amino acids, with a specific sequence that includes a signal peptide, indicating it may be secreted .

  • Function: Although its exact function is unknown, Rv2576c is predicted to be a conserved membrane protein involved in cell wall and cell processes .

Expression and Production

Recombinant Rv2576c/MT2652 is produced using E. coli as the host organism. This involves inserting the gene encoding Rv2576c into a plasmid, which is then introduced into E. coli cells. The bacteria are cultured under controlled conditions to express the protein, which is subsequently purified for use in research .

Product DetailsDescription
Source (Host)E. coli
SpeciesMycobacterium tuberculosis
TagHis-Tagged
Protein LengthFull Length (1-154)
Storage BufferTris-based buffer, 50% glycerol

Research Findings and Pathways

  • Pathways and Interactions: Rv2576c is predicted to be involved in several pathways, though specific details are not well-defined. It interacts with other proteins and molecules, which can be studied using techniques like yeast two-hybrid or co-immunoprecipitation .

  • Proteomics: Identified in culture filtrates and whole cell lysates of M. tuberculosis, suggesting it is secreted .

  • Mutant Studies: Non-essential for in vitro growth of M. tuberculosis H37Rv, indicating it may not be crucial for basic survival but could play roles in pathogenesis or adaptation .

Applications in Research

  • ELISA Kits: Available for detecting Rv2576c/MT2652, facilitating studies on its expression and interaction with other molecules .

  • Recombinant Protein: Used in various biochemical assays to understand its function and potential role in disease mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Target Names
Rv2576c, MT2652
Target Protein Sequence
MPAGVGNASGSVLDMTSVRTVPSAVALVTFAGAALSGVIPAIARADPVGHQVTYTVTTTS DLMANIRYMSADPPSMAAFNADSSKYMITLHTPIAGGQPLVYTATLANPSQWAIVTASGG LRVNPEFHCEIVVDGQVVVSQDGGSGVQCSTRPW
Uniprot No.

Q&A

What is Recombinant Uncharacterized Protein Rv2576c/MT2652?

Recombinant Uncharacterized Protein Rv2576c/MT2652 is a protein derived from the bacterium Mycobacterium tuberculosis, specifically from the gene Rv2576c. Despite its "uncharacterized" designation, research suggests it is a conserved membrane protein potentially involved in cell wall processes and tuberculosis pathogenesis. The full-length protein consists of 154 amino acids and includes a signal peptide, indicating it may be secreted by the bacterium during infection or growth. As a recombinant protein, it is typically expressed in Escherichia coli for research purposes, enabling large-scale production and purification for various experimental applications.

What are the structural features and molecular characteristics of Rv2576c?

The Rv2576c protein consists of 154 amino acids with a specific sequence that includes a signal peptide. While detailed structural information is limited in the available literature, the presence of a signal peptide suggests it undergoes secretion or membrane localization. Proteomics studies have identified this protein in both culture filtrates and whole cell lysates of M. tuberculosis, further supporting its predicted secretory nature. The protein is commonly expressed with a histidine tag (His-tag) for purification purposes when produced recombinantly . The conserved nature of this membrane protein suggests evolutionary importance, though tertiary structure predictions would require additional computational or crystallographic studies beyond what is currently documented.

What expression systems are optimal for producing Recombinant Rv2576c?

For Rv2576c production, E. coli represents the most commonly used expression system due to its efficiency and scalability . The expression process typically involves inserting the Rv2576c gene into a plasmid vector containing appropriate promoters and selection markers, followed by transformation into competent E. coli cells. Most successful expression strategies utilize bacterial strains optimized for recombinant protein production, such as BL21(DE3) or its derivatives . Expression conditions require careful optimization of temperature (often lowered to 18-25°C), induction timing, and inducer concentration to maximize protein yield while minimizing formation of inclusion bodies. For proteins with complex folding requirements or disulfide bonds, newer vesicle-based expression technologies represent an innovative approach, as they compartmentalize proteins within a micro-environment that enables production of otherwise challenging proteins from bacteria .

What purification strategy yields the highest purity and biological activity of Rv2576c?

A multi-step purification strategy is typically optimal for Rv2576c. Since the recombinant protein is commonly expressed with a His-tag, immobilized metal affinity chromatography (IMAC) serves as the primary purification step . This is usually followed by size exclusion chromatography to remove aggregates and impurities of different molecular weights. For research requiring exceptionally high purity, additional ion exchange chromatography may be employed. The vesicle-based expression system offers an alternative approach, where the vesicle-packaged proteins can be isolated from the culture by differential centrifugation, potentially preserving the protein in a native-like membrane environment that maintains its functional state . This approach allows for efficient downstream processing and long-term storage of active protein, which is particularly valuable for membrane proteins like Rv2576c .

How can researchers optimize solubility and yield of Rv2576c in E. coli?

Optimizing Rv2576c solubility in E. coli requires a multi-faceted approach. First, expression temperature reduction (to 16-25°C) and lowered inducer concentrations can significantly improve proper folding. Second, co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ) may facilitate correct protein folding. Third, using specialized E. coli strains with enhanced disulfide bond formation capabilities (like Origami or SHuffle) could be beneficial if the protein contains disulfide bonds . For membrane proteins like Rv2576c, the innovative vesicle-based expression system represents a particularly promising approach, as it exports recombinant proteins in membrane-bound vesicles, creating a micro-environment that enables production of otherwise challenging insoluble or toxic proteins . This technology not only supports isolation from the culture but also allows long-term storage of active protein for downstream applications .

Optimization ParameterTraditional MethodVesicle-Based Expression
Expression Temperature18-25°C (reduced)30-37°C (standard)
Inducer Concentration0.1-0.5 mM IPTG (reduced)0.5-1.0 mM IPTG (standard)
Cell CompartmentCytoplasmic, often forming inclusion bodiesMembrane-bound vesicles
Protein SolubilityOften limited, requires optimizationEnhanced by vesicle microenvironment
Purification ApproachCell lysis, multiple chromatography stepsVesicle isolation by differential centrifugation
Storage StabilityVariable, may require specialized buffersEnhanced long-term stability within vesicles

What methods are most effective for determining the structure of Rv2576c?

For structural elucidation of Rv2576c, a combinatorial approach is recommended. X-ray crystallography remains the gold standard but requires high-purity crystallizable protein, which can be challenging for membrane proteins. Nuclear Magnetic Resonance (NMR) spectroscopy offers an alternative for obtaining structural information in solution but is limited by protein size. For membrane proteins like Rv2576c, cryo-electron microscopy (cryo-EM) has emerged as a powerful technique, as it allows visualization of proteins in their near-native states without crystallization. Computational approaches using homology modeling based on structurally similar proteins can provide preliminary structural insights. Circular dichroism (CD) spectroscopy can determine secondary structure content (α-helices, β-sheets), while limited proteolysis coupled with mass spectrometry can identify domain boundaries and flexible regions. The vesicle-based expression system might offer advantages for structural studies by maintaining the protein in a membrane environment similar to its native state .

How can researchers investigate the putative functions of Rv2576c in Mycobacterium tuberculosis?

Investigating Rv2576c's functions requires a multi-disciplinary approach. Gene knockout or knockdown studies using CRISPR-Cas9 or antisense RNA can reveal phenotypic changes and provide insights into the protein's physiological role. Complementation assays, where the wild-type gene is reintroduced into knockout strains, confirm whether observed phenotypes are directly attributable to Rv2576c. Transcriptomic and proteomic analyses under various growth conditions or stress factors can identify conditions that modulate Rv2576c expression, suggesting functional contexts. Protein-protein interaction studies using pull-down assays, yeast two-hybrid systems, or proximity labeling approaches can identify binding partners and implicate Rv2576c in specific cellular pathways. For membrane proteins involved in cell wall processes, lipidomic analysis of knockout strains may reveal alterations in cell envelope composition. In vivo infection models comparing wild-type and Rv2576c-deficient M. tuberculosis can assess the protein's contribution to virulence, persistence, or immune evasion.

What bioinformatic approaches can predict potential functional domains and interactions of Rv2576c?

Several bioinformatic approaches can illuminate Rv2576c's functional landscape. Sequence-based analyses using tools like InterPro, Pfam, and SMART can identify conserved domains, motifs, or functional sites. Transmembrane topology prediction tools (TMHMM, Phobius) can map membrane-spanning regions, which is crucial for membrane proteins like Rv2576c. Structural prediction using AlphaFold or I-TASSER can generate three-dimensional models revealing potential binding pockets or catalytic sites. Comparative genomics analyzing gene neighborhood conservation across mycobacterial species can provide functional context through guilt-by-association principles. Protein-protein interaction prediction using tools like STRING integrates various evidence sources to suggest potential binding partners. Molecular docking simulations can explore interactions with candidate ligands or substrates. Phylogenetic analysis can trace the evolutionary history of Rv2576c, potentially revealing functional divergence or conservation across bacterial species. These computational approaches generate hypotheses that should be experimentally validated but provide valuable direction for focused functional studies.

How can Rv2576c be utilized in tuberculosis vaccine development research?

Rv2576c presents several potential applications in tuberculosis vaccine research. As a membrane protein expressed by M. tuberculosis, it could serve as an antigen candidate in subunit vaccines, particularly if it elicits strong T-cell responses. Researchers should first evaluate its immunogenicity by testing purified recombinant Rv2576c for activation of immune cells isolated from TB patients and healthy controls. Epitope mapping using peptide libraries spanning the Rv2576c sequence can identify specific regions recognized by T or B cells. Animal immunization studies using Rv2576c alone or in combination with established TB antigens and appropriate adjuvants would assess protective efficacy against subsequent M. tuberculosis challenge. The vesicle-based expression system might prove particularly valuable here, as it could generate membrane vesicles displaying Rv2576c in its native conformation, potentially serving as a novel vaccine delivery platform . Additionally, comparative studies of Rv2576c sequence conservation across clinical M. tuberculosis isolates would establish its suitability as a broadly protective antigen.

What experimental designs are appropriate for studying Rv2576c interactions with host immune factors?

Studying Rv2576c interactions with host immunity requires carefully designed experiments spanning from molecular to cellular levels. In vitro binding assays using surface plasmon resonance or bio-layer interferometry can quantify interactions between purified Rv2576c and candidate host receptors or immune factors. Cell-based assays exposing macrophages, dendritic cells, or neutrophils to purified Rv2576c can assess activation patterns by measuring cytokine production, surface marker expression, and signaling pathway activation. Human studies comparing immune responses to Rv2576c between active TB patients, latently infected individuals, and healthy controls might reveal correlations with disease states or protection. RNA sequencing of host cells following Rv2576c exposure can identify global transcriptional responses illuminating affected pathways. The vesicle-packaged Rv2576c might offer advantages by presenting the protein in a more physiologically relevant context, potentially preserving epitopes or functional domains that might be altered in conventional recombinant preparations .

How can researchers design experiments to identify small molecule inhibitors targeting Rv2576c?

The design of experiments to identify Rv2576c inhibitors should follow a systematic drug discovery pipeline. Initially, in silico approaches using the predicted or experimentally determined structure of Rv2576c can enable virtual screening of compound libraries to identify candidate binders to potential active sites or protein-protein interaction interfaces. Development of a biochemical assay relevant to Rv2576c's function (when established) would enable high-throughput screening of compound libraries. For membrane proteins without known enzymatic activity, thermal shift assays or surface plasmon resonance can detect compound binding. Cell-based phenotypic screens comparing wild-type and Rv2576c-overexpressing M. tuberculosis can identify compounds with differential growth inhibition, suggesting specific targeting. Structure-activity relationship studies of hit compounds can guide medicinal chemistry optimization. The innovative vesicle-packaged expression system could prove valuable for these studies by providing the protein in a membrane environment that better recapitulates its native state, potentially preserving binding sites that might be disrupted in detergent-solubilized preparations .

What are the common challenges in working with Rv2576c and how can they be addressed?

Common challenges with Rv2576c stem from its membrane protein nature and uncharacterized status. Expression difficulties often include low yields, improper folding, and inclusion body formation. These can be addressed through optimization of expression conditions (temperature, media composition, inducer concentration) and exploration of specialized expression systems like the vesicle-based approach, which creates a micro-environment that enables production of otherwise challenging insoluble proteins . Purification challenges include maintaining protein stability and function during solubilization and chromatography steps. Screening multiple detergents or using amphipols can improve membrane protein stability. Functional characterization is hampered by limited knowledge of the protein's physiological role. Researchers should develop multiple complementary assays based on bioinformatic predictions and known membrane protein functions in mycobacteria. For structural studies, protein heterogeneity can impede crystallization. Engineering more stable variants through targeted mutations or using antibody fragments to stabilize specific conformations may improve results.

How should researchers validate the quality and functionality of purified Rv2576c for experiments?

Rigorous quality assessment of purified Rv2576c should include multiple analytical methods. SDS-PAGE combined with western blotting confirms protein identity, purity, and integrity. Mass spectrometry provides precise molecular weight determination and can identify post-translational modifications or truncations. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) assesses sample homogeneity and oligomeric state. Circular dichroism spectroscopy verifies proper secondary structure formation. For membrane proteins, detergent content analysis ensures appropriate solubilization. Thermal shift assays can evaluate protein stability and identify buffer conditions that enhance it. Since Rv2576c's specific function remains uncharacterized, functional validation might include binding assays with predicted interacting partners or lipids, or activity assays if homology suggests enzymatic function. For proteins expressed using the vesicle-based system, vesicle integrity and protein orientation within the membrane should be assessed using techniques like negative-stain electron microscopy and protease protection assays .

What are the best methods for studying Rv2576c localization and trafficking in Mycobacterium tuberculosis?

Investigating Rv2576c localization in M. tuberculosis requires specialized techniques for mycobacterial cell biology. Genetic fusion approaches using fluorescent proteins (such as mCherry or GFP optimized for mycobacteria) can enable live-cell imaging of Rv2576c localization, though care must be taken that tags don't disrupt localization signals. Immunofluorescence microscopy using antibodies against native Rv2576c or epitope tags provides an alternative approach that avoids potential disruption of trafficking signals. Subcellular fractionation followed by western blotting can biochemically verify membrane association and distinguish between cytoplasmic membrane, cell wall, and outer membrane fractions. Immuno-electron microscopy offers nanometer-resolution localization within the complex mycobacterial cell envelope. Pulse-chase experiments using inducible expression systems can track protein movement over time. For studying protein dynamics, fluorescence recovery after photobleaching (FRAP) or photoactivatable fluorescent proteins can measure diffusion rates within membranes. These approaches should be complemented by bioinformatic analysis of sorting signals and proteomics studies of various subcellular fractions to build a comprehensive understanding of Rv2576c's cellular distribution.

How can systems biology approaches be applied to understand Rv2576c's role in the mycobacterial regulatory network?

Systems biology offers powerful frameworks for contextualizing Rv2576c within M. tuberculosis biology. Network analysis integrating transcriptomic, proteomic, and metabolomic data can position Rv2576c within specific regulatory circuits or metabolic pathways. Conditional gene expression experiments comparing wild-type and Rv2576c-deficient strains across diverse growth conditions can establish condition-specific phenotypes through global -omics profiling. Computational models incorporating these datasets can predict the consequences of Rv2576c perturbation on bacterial physiology. Chromatin immunoprecipitation sequencing (ChIP-seq) targeting transcription factors can identify regulators controlling Rv2576c expression, placing it within transcriptional hierarchies. Synthetic biology approaches systematically altering Rv2576c expression levels or creating chimeric proteins can reveal functional thresholds and domain contributions. Multi-strain comparative genomics analyzing natural variation in Rv2576c sequence and expression across clinical isolates may correlate with virulence phenotypes. These approaches collectively overcome the limitations of traditional reductionist methods for understanding uncharacterized proteins by examining them within their full biological context.

What are the latest methodological advances for studying difficult-to-express membrane proteins like Rv2576c?

Recent technological advances offer new opportunities for studying challenging membrane proteins like Rv2576c. Cell-free expression systems provide a controlled environment for membrane protein production, enabling direct incorporation into nanodiscs or liposomes. Innovative display technologies such as ribosome display and phage display can facilitate directed evolution of more stable or soluble variants. The vesicle-based expression system represents a particularly promising approach, as it exports recombinant proteins in membrane-bound vesicles from E. coli, creating a micro-environment that enables production of otherwise challenging insoluble or toxic proteins . This technology supports isolation from the culture and allows long-term storage of active protein . Microfluidic approaches for lipidic cubic phase crystallization have enhanced membrane protein structural determination. Cryo-electron tomography can visualize membrane proteins in their cellular context at near-atomic resolution. Native mass spectrometry techniques have advanced to analyze intact membrane protein complexes with bound lipids. The integration of these methodological advances provides researchers with an expanded toolkit for overcoming the traditional challenges associated with membrane protein research.

How can Rv2576c research contribute to understanding mycobacterial adaptation during infection?

Rv2576c research could provide valuable insights into mycobacterial adaptation mechanisms during infection. Temporal expression analysis of Rv2576c during different infection phases (early, latent, reactivation) using reporter strains in animal models can establish its regulation pattern in vivo. Comparative transcriptomics of wild-type and Rv2576c-deficient M. tuberculosis within macrophages, granulomas, or animal models can identify downstream pathways affected by its absence. As a predicted membrane protein involved in cell wall processes, Rv2576c may contribute to remodeling the mycobacterial envelope in response to host environments. This hypothesis could be tested through lipidomic and glycomic analysis of the cell envelope composition under various infection-relevant stresses. Interaction studies with host factors using methods like proximity labeling could identify specific host targets. The development of conditional knockdown strains would allow temporal control of Rv2576c expression during ongoing infection, revealing stage-specific requirements. These approaches collectively could establish whether Rv2576c contributes to the remarkable adaptability of M. tuberculosis within diverse host microenvironments, potentially identifying new vulnerability points for therapeutic intervention.

What are the most promising future research directions for understanding Rv2576c function?

The most promising research directions for Rv2576c involve integrative approaches combining structural biology, functional genomics, and infection models. High-resolution structural determination through cryo-EM or X-ray crystallography would provide crucial insights into potential functional sites and interaction surfaces. CRISPR interference-based functional genomics screens could identify synthetic lethal interactions, revealing pathways functionally connected to Rv2576c. Development of small molecule probes specifically targeting Rv2576c would enable acute chemical genetics approaches complementing genetic knockouts. Host-pathogen interaction studies during infection could position Rv2576c within the complex dynamics of TB pathogenesis. The innovative vesicle-based expression system offers particularly exciting possibilities for studying membrane proteins like Rv2576c, as it creates micro-environments that enable production and manipulation of otherwise challenging proteins . This technology could facilitate structural studies, antibody development, and functional characterization. Comparative analysis across mycobacterial species could reveal evolutionary patterns informing functional importance. These complementary approaches collectively promise to transform Rv2576c from an "uncharacterized protein" to a well-understood component of mycobacterial biology.

How should researchers interpret contradictory results from different experimental systems studying Rv2576c?

When faced with contradictory results in Rv2576c research, systematic reconciliation approaches are essential. First, carefully examine methodological differences between studies, as expression systems, purification methods, and experimental conditions can profoundly impact membrane protein behavior . For instance, results from detergent-solubilized preparations may differ from those obtained using the vesicle-based expression system that maintains a membrane environment . Second, consider biological context differences—results from in vitro studies may not translate to cellular systems due to missing interaction partners or post-translational modifications. Third, examine strain differences, as M. tuberculosis clinical isolates show genetic diversity that might affect Rv2576c function. Fourth, develop orthogonal assays that measure the same parameter through different techniques to distinguish genuine biological phenomena from technical artifacts. Collaborative research involving laboratories with complementary expertise can help resolve discrepancies through standardized protocols and reagent sharing. Publication of negative results and methodological details is crucial for community progress. Rather than viewing contradictions as obstacles, they should be embraced as opportunities to uncover complexity in Rv2576c biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.