Recombinant Uncharacterized protein Rv2578c/MT2655 (Rv2578c, MT2655)

Shipped with Ice Packs
In Stock

Description

Introduction to Rv2578c/MT2655

Rv2578c/MT2655 is a conserved hypothetical protein encoded by the Rv2578c gene in the Mycobacterium tuberculosis H37Rv genome. The protein consists of 340 amino acids and is classified as functionally uncharacterized, though it contains a Radical SAM domain suggesting potential enzymatic activity . Despite extensive genomic annotation efforts, many proteins in the M. tuberculosis proteome, including Rv2578c, remain incompletely characterized in terms of their precise biological functions .

The protein has been identified in multiple mycobacterial genomic studies and is assigned the UniProt ID P65023 . While initially categorized simply as a conserved hypothetical protein, recent bioinformatic analyses and experimental studies have begun to provide insights into its potential roles and structural characteristics. Understanding such uncharacterized proteins is crucial for comprehending the complex biology of M. tuberculosis and potentially identifying novel drug targets.

Recombinant Protein Properties

The recombinant form of the protein has been produced with an N-terminal His-tag to facilitate purification, with the following characteristics:

PropertyDescription
SourceExpressed in E. coli
TagN-terminal His-tag
LengthFull Length (1-340 aa)
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C, avoid repeated freeze-thaw cycles

The recombinant protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage . These specifications enable researchers to work with a highly purified form of the protein for various biochemical and functional studies.

Genomic Location and Neighborhood

Rv2578c is located in the M. tuberculosis H37Rv genome at coordinates 2902509-2903531 on the negative strand, comprising 1,023 base pairs . Its genomic context provides important clues about potential functional relationships:

FeatureInformation
Genomic Position2902509-2903531
Strand OrientationNegative (-)
Length1,023 bp
Neighboring GenesRv2579 (upstream)

Interestingly, the gene has been identified as part of a region designated RD727 (spanning positions 2902567-2904318, affecting Rv2578c-Rv2579), which appears to be deleted in certain strains of Mycobacterium africanum . This differential presence across mycobacterial species suggests potential evolutionary adaptations that may relate to pathogenicity or host specificity.

Homology and Conservation

Sequence comparison analyses reveal that Rv2578c shares significant homology with hypothetical proteins in several other bacterial species:

  1. Streptomyces coelicolor protein SC9C7.17c (348 aa) - 47.6% identity over 355 aa overlap

  2. Pseudomonas aeruginosa protein PA0069 (352 aa) - 36.6% identity over 284 aa overlap

  3. Rhizobium loti (Mesorhizobium loti) protein MLL7417 (356 aa) - 39.15% identity over 240 aa overlap

This high degree of conservation across diverse bacterial species suggests an important, albeit still uncharacterized, biological function. The presence of homologs in non-pathogenic bacteria may indicate that the protein performs a fundamental biological role rather than being specifically associated with virulence.

Transcriptomic and Mutant Studies

Multiple studies have investigated the essentiality and expression patterns of Rv2578c:

Study TypeFindingReference
TranscriptomicsmRNA identified by Microarray analysisDavis et al., 2002
MutagenesisNon-essential for in vitro growth of H37Rv in MtbYM rich mediumMinato et al., 2019
Transposon MutagenesisNon-essential gene by Himar1 transposon mutagenesisDeJesus et al., 2017; Sassetti et al., 2003; Griffin et al., 2011
Functional RequirementFound to be essential for growth on cholesterol

These studies collectively suggest that while Rv2578c is non-essential for basic in vitro growth, it may play important roles under specific growth conditions, particularly those involving cholesterol metabolism . This conditional essentiality pattern is common for genes involved in adaptation to specific environmental niches or stress conditions.

Co-regulation and Predicted Functional Associations

Network analysis indicates that Rv2578c is co-regulated in specific modules:

  1. Bicluster_0027 with residual 0.56

  2. Bicluster_0553 with residual 0.46

This co-regulation is potentially mediated by cis-regulatory motifs with significant statistical confidence (e-values ranging from 0.00 to 0.04). The co-regulated modules are enriched for biological processes including:

  • Disaccharide metabolic process

  • Trehalose metabolic process

  • Trehalose biosynthetic process

  • Disaccharide biosynthetic process

  • Carbohydrate biosynthetic process

These associations suggest that Rv2578c may play a role in carbohydrate metabolism, particularly in pathways involving trehalose, which is a critical disaccharide in mycobacterial cell wall biosynthesis and stress response.

Expression and Purification

The recombinant Rv2578c protein has been successfully expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The expression in a bacterial host suggests that the protein does not require extensive post-translational modifications for its basic structural integrity, although such modifications might be present in the native context.

Standard protein purification techniques, including affinity chromatography targeting the His-tag, have been employed to achieve greater than 90% purity as determined by SDS-PAGE analysis . This high level of purity is essential for subsequent functional and structural studies.

Current Research Applications

The recombinant Rv2578c protein serves several important research purposes:

  1. Structural studies to determine three-dimensional conformation and potential active sites

  2. Biochemical assays to test for predicted enzymatic activities, particularly those associated with Radical SAM domain proteins

  3. Interaction studies to identify binding partners and potential involvement in protein complexes

  4. Immunological research to assess potential antigenicity and vaccine applications

  5. Drug discovery efforts targeting novel M. tuberculosis proteins with unique functions

Each of these applications contributes to the broader understanding of M. tuberculosis biology and may inform new approaches to tuberculosis diagnosis, prevention, or treatment.

Future Research Directions

Several promising avenues for future research on Rv2578c include:

  1. Detailed enzymatic characterization to confirm its predicted role in Radical SAM protein family

  2. Crystallographic or cryo-EM studies to determine high-resolution structure

  3. Gene knockout and complementation studies under various growth conditions to better understand its physiological role

  4. Transcriptomic and proteomic analyses to identify conditions that modulate its expression

  5. Investigation of its potential role in trehalose metabolism as suggested by co-expression analysis

As analytical technologies advance, our understanding of uncharacterized proteins like Rv2578c will continue to improve, potentially revealing new insights into M. tuberculosis pathogenesis and metabolism.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Target Names
Rv2578c, MT2655
Target Protein Sequence
MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAAL PFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWR RETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQV PVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEH LDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSY REMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF
Uniprot No.

Q&A

What is Rv2578c and what are its basic genomic characteristics?

Rv2578c is classified as a Radical SAM domain protein in Mycobacterium tuberculosis. It is encoded by a gene located at positions 2902509-2903531 on the negative strand of the M. tuberculosis genome. The gene spans 1,023 nucleotides, encoding a protein of 340 amino acids in length . The protein is also referred to as MT2655 in some databases, representing the corresponding gene annotation in certain M. tuberculosis strains. The protein is currently categorized as "uncharacterized," indicating that its precise biochemical and cellular functions have not been fully elucidated through experimental validation.

What functional domains and structural features are predicted in Rv2578c?

Rv2578c contains a Radical SAM domain, which suggests it belongs to the superfamily of enzymes that use S-adenosylmethionine (SAM) as a cofactor to generate radicals for various biochemical reactions . These enzymes typically contain iron-sulfur clusters and catalyze diverse reactions including unusual methylations, isomerizations, sulfur insertions, ring formations, and complex rearrangements.

The protein sequence characteristics are summarized in the following table:

FeatureDetails
Gene ProductRadical SAM domain protein
Feature TypeCDS
Genomic Location2902509-2903531
StrandNegative (-)
Length1,023 bp
Protein Length340 amino acids
Transcription FactorNo

What is known about the gene expression patterns of Rv2578c?

Rv2578c has been identified in co-expression modules, specifically:

  • Bicluster_0027 with a residual value of 0.56

  • Bicluster_0553 with a residual value of 0.46

These co-expression patterns are potentially regulated by cis-regulatory motifs, with e-values of 0.00 and 0.04 for bicluster_0027, and 0.00 and 0.01 for bicluster_0553 . The gene appears to be associated with specific metabolic processes based on GO term enrichment analysis of these modules, including:

  • Disaccharide metabolic processes

  • Trehalose metabolic and biosynthetic processes

  • Disaccharide biosynthetic processes

  • Carbohydrate biosynthetic processes

What experimental methods are recommended for initial characterization of Rv2578c?

For uncharacterized proteins like Rv2578c, a systematic approach combining multiple experimental techniques is recommended:

  • Recombinant Protein Expression and Purification:

    • Clone the rv2578c gene into an appropriate expression vector with a histidine or other affinity tag

    • Express in E. coli or mycobacterial expression systems

    • Optimize expression conditions (temperature, induction time, concentration of inducer)

    • Purify using affinity chromatography followed by size exclusion chromatography

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy for secondary structure assessment

    • X-ray crystallography or cryo-EM for high-resolution structure

    • NMR for dynamic structural information

    • In silico structural prediction using homology modeling

  • Biochemical Activity Assays:

    • Based on Radical SAM domain presence, test for:

      • S-adenosylmethionine binding

      • Iron-sulfur cluster reconstitution

      • Radical generation capabilities

      • Substrate screening based on metabolic pathway associations

  • Genetic Approaches:

    • Gene knockout or knockdown studies (mutants are available)

    • Complementation assays

    • Growth phenotype characterization in various conditions, especially on cholesterol as a carbon source

How should researchers approach functional characterization of Rv2578c considering its predicted role in metabolism?

Given the association of Rv2578c with disaccharide and trehalose metabolism based on co-expression data , researchers should consider:

  • Metabolomic Analysis:

    • Compare metabolite profiles between wild-type and rv2578c mutant strains

    • Focus on trehalose and related disaccharide levels

    • Use LC-MS/MS for comprehensive metabolite analysis

  • Pathway-Specific Assays:

    • Measure trehalose synthesis and degradation rates

    • Analyze disaccharide synthesis enzyme activities in presence/absence of Rv2578c

    • Investigate potential protein-protein interactions with known trehalose metabolism enzymes

  • Growth Condition Variations:

    • Test growth phenotypes under various carbon sources

    • Particularly examine growth on cholesterol as Rv2578c has been found to be important for growth on this substrate

    • Test stress conditions that might implicate trehalose as an osmoprotectant

  • Experimental Design Considerations:

    • Include appropriate controls following randomized complete block design principles

    • Ensure biological replicates are used to account for variability

    • Follow proper experimental design principles to minimize confounding variables

How can researchers investigate the co-regulation of Rv2578c with other genes in its biclusters?

To understand the co-regulatory network of Rv2578c:

  • Transcriptomic Analysis:

    • Perform RNA-Seq under conditions relevant to disaccharide metabolism

    • Compare expression patterns of Rv2578c with other genes in biclusters 0027 and 0553

    • Validate co-expression using qRT-PCR for selected genes

  • Promoter Analysis:

    • Characterize the identified cis-regulatory motifs (e-values 0.00 and 0.04 for bicluster_0027, and 0.00 and 0.01 for bicluster_0553)

    • Perform promoter fusion studies with reporter genes

    • Conduct chromatin immunoprecipitation (ChIP) to identify transcription factors binding to these motifs

  • Network Analysis:

    • Construct gene co-expression networks

    • Identify key hub genes and potential master regulators

    • Use statistical approaches to distinguish direct from indirect interactions

  • Experimental Design Considerations:

    • When designing experiments involving multiple factors (e.g., growth conditions, genetic backgrounds), consider Latin Square Design to efficiently control for multiple sources of variation

    • Carefully randomize experimental units to minimize bias

    • Plan for proper replication to ensure statistical power

What approaches are recommended for resolving contradictory data regarding Rv2578c function?

When faced with contradictory results in Rv2578c characterization, a structured approach is necessary:

  • Systematic Review of Methodological Differences:

    • Compare experimental conditions across studies (media, growth phase, strain backgrounds)

    • Assess differences in protein preparation methods

    • Review analytical techniques and their limitations

  • Direct Replication Studies:

    • Perform side-by-side comparisons using multiple methodologies

    • Standardize protocols across different laboratory settings

    • Consider inter-laboratory collaboration for validation

  • Integrated Data Analysis:

    • Apply statistical methods to reconcile contradictory data

    • Consider that contradictory results may be reconciled by more carefully examining experimental conditions

    • Use meta-analysis approaches when sufficient studies are available

  • Alternative Hypotheses Testing:

    • Develop experiments specifically designed to distinguish between competing hypotheses

    • Consider that the protein may have multiple functions depending on conditions

    • Test for post-translational modifications that might affect function

What is the relationship between Rv2578c and cholesterol metabolism in M. tuberculosis?

Given that Rv2578c has been found to be important for growth on cholesterol , researchers should consider:

  • Metabolic Pathway Analysis:

    • Measure cholesterol uptake rates in wild-type vs. rv2578c mutant strains

    • Analyze intermediates of cholesterol catabolism using mass spectrometry

    • Track carbon flux through the cholesterol pathway using isotope labeling

  • Enzymatic Activity Studies:

    • Test if purified Rv2578c interacts directly with cholesterol or its metabolites

    • Investigate potential roles in specific steps of cholesterol degradation

    • Examine if the Radical SAM activity might be involved in cholesterol side-chain modification

  • Structural Biology Approaches:

    • Perform substrate binding studies with cholesterol and related compounds

    • Conduct structural analysis of Rv2578c in presence of potential substrates

    • Use molecular docking to predict interaction sites

  • Systems Biology Integration:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Map Rv2578c within the cholesterol utilization network

    • Develop predictive models of metabolic flux with and without functional Rv2578c

What are the optimal conditions for expressing and purifying recombinant Rv2578c?

For successful recombinant expression of Rv2578c:

  • Expression System Selection:

    • E. coli BL21(DE3) or similar strains for high yield

    • Consider mycobacterial expression systems for proper folding

    • Evaluate eukaryotic systems if protein toxicity is observed in bacteria

  • Vector and Tag Considerations:

    • Use pET-based vectors for T7-driven expression

    • Consider solubility-enhancing tags (MBP, SUMO) if protein aggregation occurs

    • Include TEV or similar protease cleavage sites for tag removal

  • Expression Optimization:

    • Test multiple induction temperatures (16°C, 25°C, 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Consider auto-induction media for high-density growth

  • Purification Strategy:

    • For Radical SAM proteins, perform all purification steps under anaerobic conditions when possible

    • Include reducing agents (DTT, β-mercaptoethanol) in all buffers

    • Consider iron-sulfur cluster reconstitution post-purification

    • Verify protein activity and integrity after each purification step

How should researchers approach iron-sulfur cluster reconstitution for Rv2578c?

As a Radical SAM domain protein, Rv2578c likely contains iron-sulfur clusters essential for its function:

  • Chemical Reconstitution Protocol:

    • Perform reconstitution under strictly anaerobic conditions

    • Use ferric chloride (FeCl₃) and sodium sulfide (Na₂S) in excess

    • Include DTT as a reducing agent

    • Monitor reconstitution by UV-visible spectroscopy (typical absorption peaks at ~320 nm and ~420 nm)

  • Enzymatic Reconstitution Alternative:

    • Use the iron-sulfur cluster assembly machinery (ISC system) proteins

    • Co-express Rv2578c with IscS, IscU, and IscA when possible

    • Supplement growth media with iron and cysteine

  • Cluster Stability Considerations:

    • Test buffer conditions to maximize cluster stability

    • Evaluate the effects of glycerol, salt concentration, and pH

    • Consider flash-freezing aliquots in liquid nitrogen for storage

  • Verification Methods:

    • UV-visible spectroscopy for characteristic Fe-S absorption

    • Electron paramagnetic resonance (EPR) spectroscopy

    • Iron and sulfur quantification assays

    • Activity assays specific to Radical SAM enzymes

How does Rv2578c contribute to M. tuberculosis survival during infection?

Understanding the role of Rv2578c in pathogenesis requires integrating multiple experimental approaches:

  • Infection Models:

    • Compare wild-type and rv2578c mutant strains in:

      • Macrophage infection assays

      • Animal infection models

      • Granuloma-like structures

    • Monitor bacterial survival, replication rates, and persistence

  • Stress Response Analysis:

    • Test survival under conditions mimicking host environments:

      • Hypoxia

      • Nutrient limitation

      • Acid stress

      • Oxidative and nitrosative stress

    • Investigate if Rv2578c contributes to stress adaptation

  • Host-Pathogen Interaction Studies:

    • Examine host immune response to wild-type vs. mutant

    • Investigate potential immunomodulatory effects

    • Consider metabolic adaptation to host-derived carbon sources

  • Experimental Design Considerations:

    • Use completely randomized design (CRD) for in vitro experiments with homogeneous conditions

    • Apply randomized block design (RBD) for animal experiments to control for animal-to-animal variation

    • Ensure sufficient replication for statistical power

What is the relationship between Rv2578c and trehalose metabolism in M. tuberculosis?

Given the co-expression data linking Rv2578c to trehalose metabolism , researchers should explore:

  • Metabolic Impact Analysis:

    • Compare trehalose levels in wild-type vs. rv2578c mutant

    • Analyze composition of trehalose-containing cell wall lipids

    • Measure activities of key trehalose biosynthetic enzymes

  • Pathway Integration Studies:

    • Investigate potential protein-protein interactions with OtsA/OtsB (trehalose-6-phosphate synthase/phosphatase)

    • Examine cross-talk between trehalose metabolism and cholesterol utilization

    • Consider role in trehalose recycling pathways

  • Physiological Significance Testing:

    • Evaluate osmotic stress resistance in relation to trehalose levels

    • Test thermal stress tolerance

    • Investigate desiccation resistance

  • Cell Envelope Analysis:

    • Examine changes in trehalose dimycolate (cord factor) composition

    • Analyze cell wall integrity

    • Investigate membrane permeability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.