Recombinant Uncharacterized protein Rv2599/MT2674 (Rv2599, MT2674)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-143
Protein Length
Full Length of Mature Protein
Target Names
Rv2599, MT2674
Target Protein Sequence
AAVSLISGITLLNRDVGSYIASHYRQESRDVNGTRYLCTGSPKQVATTLVKYQTPAARAS HTDTEYLRYRNNIVTVGPDGTYPCIIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSP GGPGGSK
Uniprot No.

Q&A

What is the predicted function of Rv2599/MT2674 based on sequence analysis?

While Rv2599/MT2674 remains largely uncharacterized, researchers can employ several bioinformatic approaches to predict potential functions. The protein likely plays a role in cellular information processing based on sequence homology analysis . To determine potential functions:

  • Perform sequence alignment with BLAST against characterized proteins

  • Identify conserved domains using tools like Pfam, SMART, or InterPro

  • Conduct phylogenetic analysis to identify orthologs in related species

  • Apply secondary structure prediction algorithms

These approaches should be considered starting points that generate hypotheses requiring experimental validation through methods discussed in subsequent questions.

What experimental design is recommended for initial characterization of Rv2599/MT2674?

A systematic experimental approach is necessary when characterizing previously uncharacterized proteins. Begin with a specific, testable hypothesis about the protein's function . An effective experimental design should:

  • Define clear variables:

    • Independent variables: Experimental conditions (e.g., expression levels, presence of binding partners)

    • Dependent variables: Measurable outcomes (e.g., protein activity, binding affinity)

    • Control variables: Factors held constant across experiments

  • Implement a sequential characterization strategy:

    • Express and purify the recombinant protein

    • Verify protein identity through mass spectrometry

    • Determine basic biochemical properties (size, oligomeric state, stability)

    • Assess potential interaction partners through pull-down assays

    • Conduct functional assays based on bioinformatic predictions

The experimental design should include appropriate controls to ensure validity and reproducibility of results .

How can I optimize expression and purification of recombinant Rv2599/MT2674?

Optimization of recombinant protein expression requires systematic testing of multiple parameters. For Rv2599/MT2674:

  • Expression system selection:

    • E. coli: Try BL21(DE3) for standard expression or specialized strains for potentially toxic proteins

    • Mycobacterial expression systems: Consider for native-like post-translational modifications

  • Expression vector considerations:

    • Select appropriate fusion tags (His, Strep-tag, etc.) based on purification strategy

    • Test both N-terminal and C-terminal tag placements as shown effective with similar proteins

    • Consider codon optimization for the expression host

  • Expression condition optimization:

    • Test multiple induction temperatures (16°C, 25°C, 37°C)

    • Vary inducer concentrations and induction times

    • Screen different media compositions

  • Purification approach:

    • Implement multi-step purification (affinity chromatography followed by size exclusion)

    • Include protease inhibitors during cell lysis

    • Test buffer conditions (pH, salt concentration) to maximize stability

Document and systematically test these variables to identify optimal conditions.

What RNA-binding assay protocols are recommended for testing if Rv2599/MT2674 interacts with RNA molecules?

Based on structural predictions and the possibility that Rv2599/MT2674 may function similarly to other bacterial RNA-binding proteins like RnpM/YlxR , the following RNA-binding assay protocols are recommended:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Prepare binding buffer containing 50 mM HEPES pH 8.0, 1 mM Mg(OAc)₂, 0.01% Nonidet-P40

    • Incubate purified protein with labeled RNA at 37°C for 10 minutes

    • Analyze on a 5% polyacrylamide gel at 4°C

    • Visualize using a Bio-Imaging Analyzer

  • UV Crosslinking followed by mass spectrometry:

    • Expose protein-RNA mixture to UV radiation (254 nm)

    • Digest complexes with RNase and protease

    • Analyze crosslinked peptides by mass spectrometry to identify RNA binding sites

  • RNA Immunoprecipitation (RIP):

    • Express tagged Rv2599/MT2674 in mycobacterial cells

    • Crosslink RNA-protein complexes in vivo

    • Purify using tag-specific antibodies or matrices

    • Extract and identify associated RNAs by sequencing

These methodologies should include appropriate controls, including non-binding protein controls and competitive binding assays to validate specificity.

How can I design a genetic knockout experiment to assess the physiological function of Rv2599/MT2674?

Designing a genetic knockout experiment requires careful consideration of the experimental system and potential outcomes:

  • Knockout strategy selection:

    • Complete gene deletion using homologous recombination

    • Conditional knockout systems if essential gene is suspected

    • CRISPR-Cas9 targeted mutagenesis for precise modifications

  • Experimental design considerations :

    • Independent variable: Presence/absence of functional Rv2599/MT2674

    • Dependent variables: Growth rates, stress responses, virulence in infection models

    • Controls: Wild-type strain, complemented mutant strain

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Transcriptomics to identify affected pathways

    • Biochemical assays based on predicted function

    • Animal infection models to assess virulence impacts

  • Statistical analysis plan:

    • Determine appropriate sample sizes using power analysis

    • Select suitable statistical tests for data types

    • Plan for biological and technical replicates

This comprehensive approach allows for robust assessment of the protein's physiological role.

How should I interpret contradictory results between in vitro and in vivo studies of Rv2599/MT2674?

Contradictory results between in vitro and in vivo studies are common in protein research and require systematic analysis:

  • Methodological validation:

    • Verify protein folding and activity in both systems

    • Check for experimental artifacts in each system

    • Ensure appropriate controls were included in both approaches

  • Contextual differences analysis:

    • Consider the complex cellular environment in vivo versus purified components in vitro

    • Examine potential missing cofactors or interaction partners in vitro

    • Assess post-translational modifications present only in vivo

  • Resolution strategies:

    • Design hybrid approaches that bridge in vitro and in vivo conditions

    • Use reconstituted systems with increasing complexity

    • Apply complementary techniques to address the same question

  • Data integration framework:

    ApproachStrengthsLimitationsIntegration Strategy
    In vitroControlled conditions, Mechanistic insightsMay lack physiological relevanceUse to establish biochemical mechanisms
    Cell-basedCellular context, Natural concentrationsComplex environment with many variablesValidate in vitro findings in cellular context
    In vivoPhysiological relevance, System-level effectsHighest complexity, Difficult to interpretConnect to phenotypic outcomes

Remember that contradictions often point to important biological regulatory mechanisms that warrant deeper investigation .

What cutting-edge structural biology approaches could reveal the molecular mechanism of Rv2599/MT2674?

Understanding the structure-function relationship of Rv2599/MT2674 requires advanced structural biology techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: Can visualize proteins in different conformational states

    • Application: Particularly valuable if Rv2599/MT2674 forms complexes with RNA or other proteins

    • Methodology: Prepare protein in vitrified ice, collect images at various angles, reconstruct 3D structure

  • Integrative structural biology approach:

    • Combine X-ray crystallography data with small-angle X-ray scattering (SAXS)

    • Supplement with hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Integrate computational modeling using AlphaFold2 predictions

  • Single-molecule FRET:

    • Monitor conformational changes during function

    • Track binding events with potential interaction partners

    • Provide dynamic information not available from static structures

  • Cross-linking mass spectrometry (XL-MS):

    • Map interaction surfaces between Rv2599/MT2674 and binding partners

    • Identify conformational changes upon binding

    • Complement with molecular dynamics simulations

Each approach offers unique insights, and an integrative strategy combining multiple techniques provides the most comprehensive understanding of protein structure and mechanism.

How can I design experiments to distinguish between direct and indirect effects of Rv2599/MT2674 on cellular processes?

Distinguishing direct from indirect effects requires carefully designed experiments:

  • Temporal analysis approach:

    • Monitor changes in cellular processes at multiple time points after protein perturbation

    • Early effects are more likely to be direct consequences

    • Apply time-resolved -omics techniques (transcriptomics, proteomics)

  • Dosage-dependent experiments:

    • Vary protein expression levels using inducible systems

    • Direct targets typically show proportional responses to protein levels

    • Design experiments with appropriate controls for each expression level

  • In vitro reconstitution:

    • Recreate the cellular process with purified components

    • Systematically add or remove Rv2599/MT2674 to assess direct effects

    • Compare results with cellular observations

  • Targeted mutation approach:

    • Create specific mutations that affect particular functions

    • Assess differential impacts on various cellular processes

    • Use domain swapping to create chimeric proteins

What controls should be included when performing binding studies with Rv2599/MT2674?

Robust binding studies require comprehensive controls to ensure validity of results:

  • Essential negative controls:

    • Non-binding protein with similar structure/size (e.g., bovine serum albumin)

    • Mutated version of Rv2599/MT2674 with altered binding sites

    • Pre-blocked binding sites using competing ligands

  • Critical positive controls:

    • Known binding partners of structurally similar proteins

    • Validated binding partners if any are known

    • Internal calibration standards to ensure assay functionality

  • Experimental validation controls:

    • Non-specific binding assessment (using randomized target sequences)

    • Concentration-dependent binding curves to establish specificity

    • Competition assays with unlabeled ligands

  • Control table for binding experiments:

    Control TypePurposeImplementationExpected Outcome
    No-proteinBackground signalOmit Rv2599/MT2674Minimal signal
    Denatured proteinNon-specific bindingHeat-denatured Rv2599/MT2674Significantly reduced binding
    CompetitionBinding specificityAdd unlabeled competitorDose-dependent signal reduction
    Buffer conditionOptimize bindingVary pH, salt, cofactorsIdentify optimal conditions

Systematically implementing these controls ensures that binding observations are specific, reproducible, and biologically relevant .

How can I optimize immunoprecipitation protocols to identify protein interaction partners of Rv2599/MT2674?

Optimizing immunoprecipitation (IP) protocols for identifying interaction partners requires attention to multiple factors:

  • Sample preparation optimization:

    • Test different cell lysis buffers to preserve interactions

    • Determine optimal crosslinking conditions if needed

    • Consider native versus denaturing conditions based on interaction stability

  • IP approach selection:

    • Traditional antibody-based IP if specific antibodies are available

    • Tandem affinity purification for higher stringency

    • Proximity-dependent biotin identification (BioID) for transient interactions

  • Technical considerations:

    • Include RNase inhibitors if RNA-mediated interactions are suspected

    • Optimize wash stringency to balance background reduction versus interaction preservation

    • Consider on-bead digestion for mass spectrometry analysis

  • Critical controls:

    • Lysate-only control (no antibody/bait)

    • IgG control or unrelated protein control

    • Competitive elution to confirm specificity

  • Validation strategy:

    • Reciprocal IP with identified partners

    • Orthogonal techniques (e.g., yeast two-hybrid, FRET)

    • Functional assays to confirm biological relevance

This systematic approach maximizes the chances of identifying genuine interaction partners while minimizing false positives.

What statistical approaches are recommended when analyzing functional assay data for Rv2599/MT2674?

Selecting appropriate statistical methods depends on the experimental design and data characteristics:

  • Preliminary data assessment:

    • Test for normality (Shapiro-Wilk test)

    • Assess homogeneity of variance (Levene's test)

    • Identify and handle outliers appropriately

  • Statistical test selection:

    • For comparing two conditions: t-test (parametric) or Mann-Whitney U test (non-parametric)

    • For multiple conditions: ANOVA followed by post-hoc tests (e.g., Tukey's HSD)

    • For dose-response relationships: Regression analysis

  • Advanced statistical considerations:

    • Account for multiple comparisons using Bonferroni or FDR corrections

    • Consider mixed-effects models for complex experimental designs

    • Implement bootstrapping for more robust confidence intervals

  • Statistical analysis reporting:

    • Include sample sizes, p-values, and effect sizes

    • Present confidence intervals for better interpretation

    • Provide clear statements of statistical significance

When analyzing binding data, consider specialized approaches like non-linear regression for Kd determination and statistical comparison of binding curves across different conditions .

How should I integrate -omics data to understand the broader impact of Rv2599/MT2674 on cellular processes?

Integrating multiple -omics datasets provides a comprehensive view of Rv2599/MT2674's cellular impact:

  • Multi-omics data collection strategy:

    • Transcriptomics: RNA-seq to identify affected gene expression

    • Proteomics: Mass spectrometry to detect protein-level changes

    • Metabolomics: Identify altered metabolic pathways

    • Interactomics: Capture protein-protein and protein-RNA interactions

  • Data integration frameworks:

    • Pathway enrichment analysis across all datasets

    • Network analysis to identify regulatory hubs

    • Machine learning approaches to predict functional relationships

  • Validation experimental design:

    • Select key nodes from integrated networks for targeted validation

    • Design experiments to test specific hypotheses generated from integrated analysis

    • Implement appropriate controls for each validation experiment

  • Integration analysis workflow:

    Data TypePrimary AnalysisIntegration StrategyBiological Insight
    TranscriptomicsDifferential expressionIdentify regulated pathwaysRegulatory effects
    ProteomicsProtein abundance changesCorrelate with transcript changesPost-transcriptional regulation
    InteractomicsProtein-protein interactionsMap to affected pathwaysDirect mechanisms
    Phenotypic dataCellular/organismal effectsConnect molecular changes to phenotypesFunctional significance

This comprehensive approach allows researchers to move beyond correlation to establish causative mechanisms for observed phenotypes.

What emerging technologies show promise for further characterizing Rv2599/MT2674 function?

Several cutting-edge technologies hold potential for deeper insights into Rv2599/MT2674:

  • CRISPR interference (CRISPRi) and activation (CRISPRa):

    • Allows for precise temporal control of gene expression

    • Can target specific domains through strategic guide RNA design

    • Enables screening of genetic interactions in high-throughput format

  • Single-cell analysis technologies:

    • Single-cell RNA-seq to assess cell-to-cell variability in responses

    • Single-cell proteomics to detect protein-level heterogeneity

    • Spatial transcriptomics to understand localization effects

  • In situ structural biology approaches:

    • Cryo-electron tomography to visualize proteins in cellular context

    • Live-cell super-resolution microscopy for dynamic studies

    • In-cell NMR for structural information in physiological environments

  • Artificial intelligence applications:

    • AlphaFold2 for structure prediction and functional inference

    • Machine learning analysis of multi-omics data

    • Automated hypothesis generation and experimental design optimization

These technologies, especially when integrated, promise to overcome current limitations in understanding complex protein functions within cellular contexts.

How can contradictory experimental results about Rv2599/MT2674 be resolved through systematic experimental design?

Resolving contradictions requires a structured approach to experimental design:

  • Systematic contradiction analysis:

    • Identify specific variables that differ between contradictory studies

    • Formulate testable hypotheses to explain contradictions

    • Design experiments that directly address potential sources of variation

  • Unified experimental framework:

    • Standardize protocols across different experimental systems

    • Implement identical controls and validation approaches

    • Use consistent reagents and analytical methods

  • Targeted validation experiments:

    • Design experiments that specifically test competing hypotheses

    • Include appropriate controls for each condition tested

    • Ensure statistical power to detect differences

  • Resolution strategy table:

    Contradiction TypePotential CausesExperimental ApproachExpected Outcome
    In vitro vs. in vivoMissing cofactorsSupplementation studiesIdentification of required factors
    Between conditionsContext-dependencySystematic condition testingMap of condition-specific activities
    Between techniquesMethodological biasMethod comparison studyUnderstanding of technical limitations

This systematic approach transforms contradictions from obstacles into opportunities for deeper biological insights.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.