Recombinant Uncharacterized protein Rv2876/MT2944.1 (Rv2876, MT2944.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Target Names
Rv2876, MT2944.1
Target Protein Sequence
MFGQWEFDVSPTGGIAVASTEVEHFAGSQHEVDTAEVPSAAWGWSRIDHRTWHIVGLCIF GFLLAMLRGNHVGHVEDWFLITFAAVVLFVLARDLWGRRRGWIR
Uniprot No.

Q&A

What is the genomic context of Rv2876/MT2944.1 in Mycobacterium tuberculosis?

Rv2876/MT2944.1 is an uncharacterized protein encoded in the Mycobacterium tuberculosis genome. Like other mycobacterial proteins, understanding its genomic context requires examination of both the coding sequence and surrounding intergenic regions (IGRs). Analysis of operon structures can reveal functional relationships with adjacent genes.

When investigating genomic context, researchers should:

  • Examine adjacent genes for potential co-expression patterns

  • Analyze intergenic region (IGR) coverage patterns in RNA-seq data

  • Compare the expression correlation between coding sequences and intervening IGRs

  • Assess whether the gene exists within a verified operon structure

Research indicates that genes within mycobacterial operons typically show correlation in expression levels with adjacent coding sequences and intervening IGRs, which can be visualized through raw coverage plots of individual bases .

How can I determine if Rv2876/MT2944.1 is highly expressed in different growth conditions?

To assess expression levels of Rv2876/MT2944.1 across different growth conditions, researchers should implement similar techniques to those used for other mycobacterial proteins:

  • Analyze RNA-seq data across multiple growth conditions and compare mRNA concentration values (expressed in parts per million, ppm)

  • Consider both the average expression and standard deviation across conditions

  • Compare expression profiles to well-characterized mycobacterial proteins

For reference, below is a table showing expression data for several highly expressed mycobacterial proteins:

Rv numberDesignationAvg mRNA concn (ppm)SD (ppm)Reference
Rv0288CFP-778128623
Rv0440GROEL-24,4382,38521
Rv1174cMPT8.41,1654246
Rv1886cFBPB/AG85B1,4641,16812
Rv3418cGROES5,1892,5932
Rv3874CFP-105,4143,95024
Rv3875ESAT-62,4721,2293

This comparative approach allows researchers to determine whether Rv2876/MT2944.1 falls within the range of highly expressed mycobacterial genes (>1000 ppm) or shows more moderate or condition-specific expression patterns .

What experimental controls should be included when studying Rv2876/MT2944.1 expression?

When designing experiments to study Rv2876/MT2944.1 expression, appropriate controls are essential:

  • Include positive controls: Use well-characterized mycobacterial proteins with known expression patterns such as ESAT-6 (Rv3875) and CFP-10 (Rv3874), which have established expression profiles across different conditions

  • Include negative controls: Unexpressed genomic regions or genes known to be silent under your experimental conditions

  • Include technical controls: Normalized housekeeping genes to validate RNA quality and quantity

  • Include biological replicates: At minimum, three biological replicates should be used for statistical validation

The experimental design should maintain constants (controls) such as growth media composition, temperature, aeration conditions, and sampling timepoints. For RNA extraction, consistent protocols should be applied across all samples to avoid technical variation2.

How should I design experiments to determine if Rv2876/MT2944.1 is part of an operon structure?

To determine if Rv2876/MT2944.1 is part of an operon structure, consider the following experimental design approach:

  • Generate RNA-seq data under relevant physiological conditions that might induce expression

  • Analyze both the static and dynamic genome data:

    • Static data: Intergenic region length, presence of promoter elements

    • Dynamic data: Correlation of expression between adjacent genes

  • Apply established algorithms like COSMO (Condition-Specific Mapping of Operons) that can leverage combined data sets to evaluate operon structures

  • Design RT-PCR experiments spanning Rv2876 and adjacent genes to confirm co-transcription

When analyzing operons, be aware that setting a high static coding sequence coverage cutoff as a predictive feature could cause the algorithm to bypass lowly-expressed or deliberately downregulated operons. Instead, determine if there is a correlation of expression between adjacent coding sequences that does not exist within non-operon structures .

What are the best methods to assess potential functions of Rv2876/MT2944.1 in infection models?

To assess potential functions of the uncharacterized protein Rv2876/MT2944.1 in infection models:

  • Design recombinant protein expression systems:

    • Express the protein in heterologous hosts (E. coli, M. smegmatis)

    • Purify using affinity chromatography with appropriate tags

    • Verify protein quality through SDS-PAGE and Western blotting

  • Develop functional assays based on bioinformatic predictions:

    • Structural homology to known proteins

    • Presence of conserved domains or motifs

    • Predicted subcellular localization

  • Assess immunogenicity in infection models:

    • Measure interferon-gamma (IFN-γ) responses in infected cattle or other animal models

    • Compare responses to known antigens like ESAT-6 and CFP-10

    • Use flow cytometry (e.g., Cyan ADP instrument with Summit 4.3 software) to analyze cellular responses

  • Statistical analysis:

    • Apply nonparametric tests (Wilcoxon rank sum test) for comparing immune responses

    • Use Fisher's exact test for comparing responder frequencies

    • Perform Spearman's rank correlation and linear regression analyses

    • Correct for multiple testing using the Bonferroni method

How can RNA-seq data be used to identify condition-specific regulation of Rv2876/MT2944.1?

To identify condition-specific regulation of Rv2876/MT2944.1 using RNA-seq data:

  • Generate expression profiles under various conditions:

    • Standard growth conditions

    • Stress conditions (e.g., exposure to antibiotics like rifampicin)

    • Infection models

    • Nutrient limitation

  • Analyze differential expression patterns:

    • Calculate fold changes in expression across conditions

    • Determine statistical significance using appropriate tests

    • Generate coverage plots showing expression across the gene and surrounding regions

  • Examine correlation with co-regulated genes:

    • Cluster genes with similar expression patterns

    • Identify potential regulatory networks

    • Analyze shared promoter elements or transcription factor binding sites

  • Validate findings through targeted experiments:

    • Quantitative RT-PCR

    • Reporter gene assays

    • Promoter analysis studies

Research on mycobacterial operons has demonstrated that condition-specific regulation occurs, such as when M. tuberculosis is exposed to rifampicin stress. Using combined static and dynamic data sets can reveal how operons evolve in response to specific stressors .

What is the optimal experimental design to study protein-protein interactions of Rv2876/MT2944.1?

To study protein-protein interactions of Rv2876/MT2944.1, consider this comprehensive experimental design:

  • Expression and purification of recombinant Rv2876/MT2944.1:

    • Clone the coding sequence into appropriate expression vectors

    • Express in E. coli or mycobacterial systems with affinity tags

    • Purify using column chromatography

    • Confirm protein identity by mass spectrometry

  • In vitro interaction studies:

    • Pull-down assays with mycobacterial lysates

    • Co-immunoprecipitation with suspected interaction partners

    • Surface plasmon resonance to determine binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • In vivo interaction approaches:

    • Bacterial two-hybrid assays

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation

    • Proximity-dependent biotin identification (BioID)

  • Data analysis:

    • Use statistical methods appropriate for each technique

    • Compare results across multiple methods to confirm interactions

    • Consider both static (structural) and dynamic (condition-dependent) interactions2

How should I approach contradictory data regarding Rv2876/MT2944.1 expression in different experimental conditions?

When encountering contradictory data regarding Rv2876/MT2944.1 expression:

  • Systematically analyze potential sources of variation:

    • Experimental conditions (growth phase, media composition, stress factors)

    • Strain differences (clinical isolates vs. laboratory strains)

    • Technical variation in RNA extraction or sequencing protocols

    • Bioinformatic analysis parameters

  • Design validation experiments:

    • Use multiple orthogonal techniques (RNA-seq, qRT-PCR, reporter assays)

    • Increase biological replicates to enhance statistical power

    • Carefully control for batch effects and technical variables

  • Statistical approach:

    • Perform power analysis to determine adequate sample sizes

    • Use appropriate statistical tests for data type (parametric vs. nonparametric)

    • Correct for multiple testing

    • Consider using tools like GraphPad InStat for statistical analysis and GraphPad StatMate for power analyses

  • Interpretation framework:

    • Consider condition-specific regulation

    • Examine if the gene is part of an operon with complex regulatory patterns

    • Investigate potential post-transcriptional regulation mechanisms

    • Analyze the impact of genetic background on expression patterns

What are the most effective approaches to study the impact of Rv2876/MT2944.1 deletion on Mycobacterium tuberculosis virulence?

To study the impact of Rv2876/MT2944.1 deletion on M. tuberculosis virulence:

  • Generation of knockout strains:

    • Use specialized transduction or CRISPR-Cas9 approaches

    • Create complemented strains to confirm phenotype specificity

    • Include appropriate controls (wild-type and unrelated gene deletion strains)

  • In vitro phenotypic characterization:

    • Growth curves in standard and stress conditions

    • Antibiotic susceptibility profiles

    • Cell envelope integrity assays

    • Metabolic activity measurements

  • Infection models:

    • Macrophage infection assays (measuring bacterial survival and host cell responses)

    • Animal models (assessing bacterial burden, histopathology, and survival)

    • Measure immunological parameters (cytokine profiles, T-cell responses)

  • Omics approaches for mechanistic insights:

    • Transcriptomic analysis of knockout vs. wild-type strains

    • Proteomic profiling to identify compensatory mechanisms

    • Metabolomic studies to detect metabolic perturbations

  • Statistical analysis:

    • Apply appropriate statistical tests for each data type

    • Consider using nonparametric tests for data that doesn't follow normal distribution

    • Perform correction for multiple testing when conducting genome-wide analyses

What are the optimal conditions for recombinant expression and purification of Rv2876/MT2944.1?

To optimize recombinant expression and purification of Rv2876/MT2944.1:

  • Expression system selection:

    • E. coli BL21(DE3) for high-yield expression

    • M. smegmatis for mycobacterial-specific post-translational modifications

    • Mammalian cells for complex folding requirements

    • Cell-free systems for potentially toxic proteins

  • Vector and tag optimization:

    • Test multiple fusion tags (His6, GST, MBP, SUMO)

    • Evaluate N-terminal versus C-terminal tag placement

    • Consider TEV or PreScission protease cleavage sites for tag removal

    • Codon optimization for expression host

  • Expression condition optimization:

    • Test various induction temperatures (16°C, 25°C, 37°C)

    • Evaluate different inducer concentrations

    • Optimize growth media composition

    • Determine optimal induction time and harvesting point

  • Purification strategy:

    • Implement affinity chromatography as first capture step

    • Add ion exchange chromatography for further purification

    • Include size exclusion chromatography as polishing step

    • Optimize buffer conditions for protein stability

  • Quality control:

    • SDS-PAGE analysis for purity assessment

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for aggregation evaluation

    • Circular dichroism for secondary structure verification

Each optimization step should be systematically tested and documented to establish a reproducible protocol for high-quality protein production .

How should I analyze the immunogenicity of Rv2876/MT2944.1 in comparison to established mycobacterial antigens?

To analyze the immunogenicity of Rv2876/MT2944.1 in comparison to established antigens:

  • Study design considerations:

    • Include appropriate subject groups (infected, naïve, vaccinated)

    • Ensure adequate sample sizes based on power analysis

    • Include well-characterized antigens (ESAT-6, CFP-10) as comparators

    • Use standardized antigen preparations and concentrations

  • Cellular immunology methods:

    • IFN-γ ELISPOT assays to enumerate antigen-specific T cells

    • Intracellular cytokine staining for multiparameter analysis

    • Lymphocyte proliferation assays to measure T-cell responses

    • Flow cytometry analysis using instruments such as Cyan ADP with Summit 4.3 software

  • Humoral immunity assessment:

    • ELISA to measure antibody responses

    • Western blotting to confirm antigen recognition

    • Avidity assays to determine antibody quality

  • Data analysis approach:

    • Use nonparametric tests (Wilcoxon rank sum) when comparing immune responses

    • Apply Fisher's exact test when comparing responder frequencies

    • Correct for multiple testing using the Bonferroni method

    • Perform correlation analyses to assess relationships between different immune parameters

What bioinformatic pipelines should be used to analyze transcriptomic data for Rv2876/MT2944.1 under different stress conditions?

For analyzing transcriptomic data of Rv2876/MT2944.1 under different stress conditions:

  • Quality control and preprocessing:

    • Use FastQC for quality assessment of raw reads

    • Implement Trimmomatic or similar tools for adapter removal and quality trimming

    • Perform rRNA depletion verification

  • Read mapping and quantification:

    • Map reads to M. tuberculosis reference genome using Bowtie2 or HISAT2

    • Generate wiggle files to visualize raw coverages of individual bases

    • Quantify expression using HTSeq-count or featureCounts

    • Normalize counts using TPM or RPKM/FPKM methods

  • Differential expression analysis:

    • Apply DESeq2 or edgeR for statistical comparison between conditions

    • Set appropriate significance thresholds (adjusted p-value < 0.05)

    • Calculate fold changes between stress and control conditions

  • Operon analysis:

    • Implement condition-specific operon mapping algorithms like COSMO

    • Analyze both static genome features and dynamic expression data

    • Examine correlation patterns between adjacent genes

    • Evaluate intergenic region expression

  • Visualization and interpretation:

    • Generate coverage plots showing expression across gene regions

    • Create heatmaps to display expression changes across conditions

    • Perform hierarchical clustering to identify co-regulated genes

    • Conduct pathway enrichment analysis to understand biological context

Statistical analysis should include appropriate corrections for multiple testing, and results should be validated using orthogonal methods such as qRT-PCR for key findings .

How should I interpret conflicting results between in vitro and in vivo studies of Rv2876/MT2944.1 function?

When confronted with conflicting results between in vitro and in vivo studies:

  • Systematic evaluation framework:

    • Compare experimental conditions in detail (media, growth phase, host factors)

    • Assess differences in strain backgrounds used

    • Evaluate technical approaches and their limitations

    • Consider physiological relevance of each experimental system

  • Reconciliation strategies:

    • Design bridging experiments that gradually increase complexity

    • Develop ex vivo models that better recapitulate in vivo conditions

    • Conduct time-course experiments to capture dynamic responses

    • Analyze strain-specific differences in regulation or expression

  • Mechanistic investigation:

    • Examine post-transcriptional or post-translational regulation

    • Consider protein interactions specific to in vivo environments

    • Investigate host factor influences on protein function

    • Analyze the impact of microenvironment (pH, oxygen, nutrients)

  • Statistical considerations:

    • Evaluate statistical power in both experimental systems

    • Consider variability inherent to in vivo systems

    • Perform meta-analysis when multiple studies are available

    • Apply appropriate statistical tests based on data distribution 2

What approaches should be used to determine structure-function relationships for Rv2876/MT2944.1?

To determine structure-function relationships for Rv2876/MT2944.1:

How can I integrate transcriptomic and proteomic data to better understand Rv2876/MT2944.1 regulation?

To integrate transcriptomic and proteomic data for understanding Rv2876/MT2944.1 regulation:

  • Multi-omics experimental design:

    • Collect matched samples for both transcriptomic and proteomic analyses

    • Include multiple timepoints to capture dynamic regulation

    • Study various stress conditions relevant to M. tuberculosis pathogenesis

    • Ensure appropriate replication for statistical power

  • Data processing and normalization:

    • Process RNA-seq data through standard pipelines for expression quantification

    • Apply appropriate normalization methods for proteomics data

    • Implement batch correction when necessary

    • Convert different data types to comparable scales

  • Integration analysis approaches:

    • Calculate correlation between mRNA and protein levels

    • Identify discordant patterns suggesting post-transcriptional regulation

    • Apply multivariate statistical methods (PCA, clustering)

    • Implement specialized multi-omics integration tools

  • Regulatory network reconstruction:

    • Identify potential transcription factors regulating Rv2876/MT2944.1

    • Detect post-transcriptional regulators (small RNAs, RNA-binding proteins)

    • Map protein modification sites affecting stability or function

    • Construct condition-specific regulatory networks

  • Validation of key findings:

    • Confirm regulatory relationships through targeted experiments

    • Verify protein-protein interactions identified in network analyses

    • Test predicted regulatory mechanisms through genetic manipulation

    • Assess functional consequences of regulatory changes

This integrated approach provides a more comprehensive understanding of Rv2876/MT2944.1 regulation than either technique alone .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.