Recombinant Uncharacterized protein Rv3395c/MT3502 (Rv3395c, MT3502)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. To request a specific tag, please inform us, and we will prioritize its implementation.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Target Names
Rv3395c, MT3502
Target Protein Sequence
MTAAFASDQRLENGAEQLESLRRQMALLSEKVSGGPSRSGDLVPAGPVSLPPGTVGVLSG ARSLLLSMVASVTAAGGNAAIVGQPDIGLLAAVEMGADLSRLAVIPDPGTDPVEVAAVLI DGMDLVVLGLGGRRVTRARARAVVARARQKGCTLLVTDGDWQGVSTRLAARVCGYEITPA LRGVPTPGLGRISGVRLQINGRGR
Uniprot No.

Q&A

What is Rv3395c/MT3502 and where is it found in the Mycobacterium tuberculosis genome?

Rv3395c is a conserved hypothetical protein encoded in the genome of Mycobacterium tuberculosis H37Rv. The gene is located at coordinates 3811022-3811636 on the negative strand of the M. tuberculosis H37Rv genome. It encodes a protein of 204 amino acids in length. The protein shows some sequence similarity with RecA proteins (recombinases A), including 31.45% identity in a 140 amino acid overlap with RecA from Thiobacillus ferrooxidans and 30.25% identity in a 129 amino acid overlap with RecA from Mycobacterium smegmatis .

What expression patterns have been observed for Rv3395c in M. tuberculosis?

Expression data for Rv3395c indicates that its mRNA has been identified through microarray analysis as reported by Davis et al. (2002). Additionally, proteomics studies have detected the protein by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days post-infection but not at 90 days. This temporal expression pattern suggests a potential role during specific stages of infection. While not as extensively characterized as other mycobacterial proteins like Rv3402c (which is known to be upregulated under iron-limiting conditions and during macrophage infection), Rv3395c's expression profile offers clues to its potential involvement in adaptation to host environments .

What are the recommended protocols for recombinant expression and purification of Rv3395c protein?

For recombinant expression of Rv3395c, researchers can employ methodologies similar to those used for other mycobacterial proteins. A recommended approach involves:

  • Gene amplification from M. tuberculosis H37Rv genomic DNA using specific primers targeting the Rv3395c sequence

  • Cloning into an appropriate expression vector (e.g., pET series for E. coli expression)

  • Expression in E. coli BL21(DE3) or similar strains with IPTG induction

  • Purification via affinity chromatography (His-tag), followed by size exclusion chromatography

For functional studies, expression in mycobacterial hosts such as M. smegmatis might provide more relevant post-translational modifications. This approach would mirror methodologies used to study proteins like Rv3402c, which was successfully expressed in M. smegmatis to investigate its role in macrophage interactions . When designing constructs, researchers should consider the protein's potential membrane association or interaction with other mycobacterial components.

What genetic manipulation strategies are most effective for studying Rv3395c function in M. tuberculosis?

Multiple genetic approaches have been successfully employed to study Rv3395c function:

  • Gene knockout studies: Previous research has demonstrated that Rv3395c is non-essential for in vitro growth of H37Rv in rich medium, as determined through Himar1 transposon mutagenesis (Minato et al., 2019; DeJesus et al., 2017; Sassetti et al., 2003; Lamichhane et al., 2003) . This allows for viable knockout mutants.

  • Heterologous expression: Similar to studies with Rv3402c, expressing Rv3395c in non-pathogenic mycobacteria like M. smegmatis can provide insights into its function while working with a safer model organism .

  • Complementation studies: Reintroducing the gene into knockout mutants can confirm phenotype specificity.

  • Reporter fusions: Creating promoter-reporter or protein-reporter fusions to study expression patterns and localization.

When designing mutation studies, researchers should consider the observation that UV-induced mutagenesis does not occur in M. tuberculosis H37Rv Rv3395c-Rv3394c mutants, suggesting a potential role in DNA repair or mutation processes .

How can researchers effectively measure mutation and selection when studying the role of Rv3395c in antibiotic resistance?

Given the potential role of Rv3395c in DNA recombination or repair (based on its similarity to RecA proteins), researchers might investigate its involvement in mutation rates and antibiotic resistance development using methodologies similar to those outlined for studying mutation and selection in bacteria:

  • Fluctuation analysis: Following the approach pioneered by Luria and Delbrück, researchers can set up parallel cultures to determine whether mutations occur spontaneously or are induced in response to selective pressure . This would involve:

    • Growing multiple independent cultures of wild-type and Rv3395c mutant strains

    • Plating cultures on selective media containing antibiotics

    • Analyzing the distribution of resistant colonies

  • Measurement of mutation frequencies vs. rates: It's important to distinguish between mutation frequency (proportion of mutants in a population) and mutation rate (probability of mutation per cell division) . For Rv3395c studies, researchers should:

    • Account for population size effects

    • Use appropriate statistical methods (e.g., P0 method, MSS maximum likelihood)

    • Include proper controls to account for confounding variables

  • Zone of inhibition assays: Researchers can compare the sensitivity of wild-type and Rv3395c mutant strains to various antibiotics using disc diffusion methods, where the diameter of the zone of inhibition correlates with antibiotic sensitivity .

What is the hypothesized function of Rv3395c based on sequence homology and experimental evidence?

Based on sequence analysis and limited experimental data, several potential functions can be hypothesized for Rv3395c:

  • DNA recombination/repair role: The similarity with RecA proteins (31.45% identity with RecA from Thiobacillus ferrooxidans and 30.25% identity with RecA from M. smegmatis) suggests a potential role in DNA recombination or repair processes . This is further supported by the observation that UV-induced mutagenesis does not occur in M. tuberculosis H37Rv Rv3395c-Rv3394c mutants .

  • Infection-associated function: The detection of Rv3395c protein in guinea pig lungs at 30 days post-infection (but not at 90 days) suggests a potential role during specific stages of host colonization . By analogy with Rv3402c, which enhances mycobacterial survival within macrophages, Rv3395c might be involved in host-pathogen interactions during early to mid-stage infection .

  • Stress response: The temporal expression pattern could indicate involvement in adaptation to changing host environments or stress conditions encountered during infection.

Further experimental validation through genetic manipulation, protein interaction studies, and phenotypic characterization is needed to clarify its precise function.

How does Rv3395c potentially interact with host immune systems during infection?

While direct evidence for Rv3395c's role in host-pathogen interactions is limited, insights can be drawn from research on similar mycobacterial proteins:

By analogy with Rv3402c, which has been shown to enhance mycobacterial survival within macrophages and modulate pro-inflammatory cytokine production via NF-κB/ERK/p38 signaling , researchers might investigate whether Rv3395c similarly affects:

  • Intracellular survival: Does expression of Rv3395c in non-pathogenic mycobacteria (like M. smegmatis) enhance survival within macrophages?

  • Cytokine modulation: Does Rv3395c affect the production of pro-inflammatory cytokines like TNF-α and IL-1β?

  • Host cell death: Does Rv3395c expression influence host cell viability during infection?

Experimental approaches could include heterologous expression in M. smegmatis followed by macrophage infection assays, similar to those used for characterizing Rv3402c . Additionally, comparing cytokine profiles induced by wild-type and Rv3395c-knockout M. tuberculosis strains could provide insights into its immunomodulatory potential.

What role might Rv3395c play in M. tuberculosis antibiotic resistance mechanisms?

Given Rv3395c's potential involvement in DNA recombination/repair (based on RecA homology) and the observation that UV-induced mutagenesis is affected in Rv3395c-Rv3394c mutants , researchers might investigate its role in antibiotic resistance through several angles:

  • Spontaneous mutation rates: RecA-like proteins can influence DNA repair and recombination, potentially affecting the rate of spontaneous mutations that confer antibiotic resistance. Researchers could compare mutation frequencies to antibiotics like streptomycin in wild-type versus Rv3395c mutant strains .

  • Stress-induced mutagenesis: Does Rv3395c participate in stress-induced mutagenesis pathways that might be activated under antibiotic pressure?

  • DNA damage response: Given the potential RecA-like function, does Rv3395c participate in the response to DNA-damaging antibiotics?

Methodologically, researchers could adapt approaches similar to those used in antibiotic resistance studies with Serratia marcescens , including fluctuation analysis to determine if Rv3395c affects the pattern of spontaneous versus induced mutations.

How does Rv3395c expression change under various stress conditions relevant to TB pathogenesis?

Stress ConditionExpression ChangeDetection MethodTime PointReference
Guinea pig lung infectionDetectableMass spectrometry30 days post-infectionKruh et al., 2010
Guinea pig lung infectionNot detectableMass spectrometry90 days post-infectionKruh et al., 2010
Standard in vitro cultureDetectableMicroarrayN/ADavis et al., 2002

While comprehensive stress response data for Rv3395c is limited, researchers could investigate its expression under conditions relevant to TB pathogenesis, including:

  • Hypoxia: Does oxygen limitation affect Rv3395c expression?

  • Nutrient starvation: Is expression altered during carbon or nitrogen limitation?

  • Acidic pH: Does Rv3395c respond to phagosomal pH conditions?

  • Oxidative/nitrosative stress: Is expression affected by reactive oxygen or nitrogen species?

  • Iron limitation: By analogy with Rv3402c, which is iron-regulated , does iron availability affect Rv3395c expression?

Researchers should employ qRT-PCR, RNA-seq, and proteomics approaches to monitor expression changes under these conditions, comparing results with known stress-responsive genes as controls.

What structural features of Rv3395c might contribute to its potential RecA-like function?

Advanced structural biology approaches could reveal key insights into Rv3395c's function:

  • Protein crystallography or cryo-EM: Determining the three-dimensional structure would reveal structural similarities to RecA proteins and potential functional domains.

  • Domain analysis: Computational prediction and experimental validation of DNA-binding domains, ATP-binding sites, or other functional motifs.

  • Structure-function relationship studies: Site-directed mutagenesis of predicted key residues followed by functional assays.

  • Protein-protein interaction studies: Identifying binding partners could provide clues to its functional network, particularly whether it interacts with other DNA repair/recombination proteins.

Given the protein's sequence (as provided in the search results) , researchers should focus on regions showing highest conservation with known RecA proteins, as these likely represent functionally important domains.

How does the evolutionary conservation of Rv3395c across mycobacterial species correlate with pathogenicity?

Analyzing the phylogenetic distribution and sequence conservation of Rv3395c across mycobacterial species could provide insights into its role in pathogenesis:

  • Comparative genomics: Identify homologs across pathogenic and non-pathogenic mycobacteria.

  • Selective pressure analysis: Calculate dN/dS ratios to determine if the gene is under purifying or diversifying selection.

  • Correlation with virulence: Determine whether presence/absence or sequence variation correlates with pathogenicity.

  • Complementation studies: Test whether Rv3395c homologs from different mycobacterial species can functionally complement M. tuberculosis Rv3395c mutants.

This evolutionary approach could reveal whether Rv3395c represents a core mycobacterial function or a specialized adaptation in pathogenic species.

What are the main challenges in expressing and purifying recombinant Rv3395c protein?

Researchers working with recombinant Rv3395c may encounter several technical challenges:

  • Protein solubility: Mycobacterial proteins often pose solubility challenges when expressed in E. coli. Solutions include:

    • Optimization of expression conditions (temperature, induction time, inducer concentration)

    • Use of solubility tags (MBP, SUMO, etc.)

    • Testing different E. coli strains (e.g., Arctic Express, Rosetta)

    • Mycobacterial expression systems as alternatives to E. coli

  • Protein stability: If Rv3395c forms part of a complex or requires specific cofactors, it might be unstable when expressed alone. Researchers might:

    • Include stabilizing agents in purification buffers

    • Co-express with potential interacting partners

    • Test different storage conditions

  • Functional assays: Given its uncharacterized nature, establishing relevant activity assays can be challenging. Researchers should consider:

    • DNA binding assays (if RecA-like function is suspected)

    • ATPase activity measurements

    • Protein-protein interaction studies

How can researchers overcome the challenges of studying Rv3395c in vivo during M. tuberculosis infection?

Studying the in vivo role of Rv3395c during infection presents several challenges:

  • Biosafety concerns: Working with virulent M. tuberculosis requires specialized facilities. Researchers might:

    • Use attenuated strains for preliminary studies

    • Employ heterologous expression in M. smegmatis

    • Collaborate with BSL-3 laboratories for validation studies

  • Temporal expression patterns: The observation that Rv3395c is detected at 30 days but not 90 days post-infection in guinea pigs suggests stage-specific roles. Researchers should:

    • Design time-course experiments to capture relevant infection stages

    • Use inducible systems for controlled expression

    • Consider multiple infection models (cell culture, animal models)

  • Redundant functions: Potential functional overlap with other mycobacterial proteins might mask phenotypes. Solutions include:

    • Creating multiple gene knockouts

    • Using conditional expression systems

    • Employing sensitive readouts for subtle phenotypic changes

What approaches can address contradictory results when studying Rv3395c function?

When faced with inconsistent or contradictory results in Rv3395c research, consider these approaches:

What emerging technologies could advance our understanding of Rv3395c function?

Several cutting-edge technologies could significantly enhance Rv3395c characterization:

  • CRISPR-Cas9 genome editing: For more precise genetic manipulation of M. tuberculosis, allowing:

    • Clean gene deletions without antibiotic markers

    • Point mutations to test specific functional hypotheses

    • CRISPRi for conditional knockdown studies

  • Cryo-electron microscopy: For structural studies without the need for protein crystallization, enabling:

    • Visualization of potential protein complexes

    • Structural characterization in near-native conditions

    • Analysis of conformational changes

  • Single-cell approaches: To understand heterogeneity in expression and function:

    • Single-cell RNA-seq of infected macrophages

    • Time-lapse microscopy with fluorescent reporters

    • Mass cytometry for protein-level analysis

  • Comparative Genomics and Systems Biology:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to place Rv3395c in functional pathways

    • Comparative analysis across mycobacterial species

How might Rv3395c research contribute to novel tuberculosis treatment approaches?

While Rv3395c is non-essential for in vitro growth , its potential role in infection and DNA repair pathways could still make it relevant for therapeutic strategies:

  • Adjunct therapies: If Rv3395c influences stress responses or DNA repair, inhibitors might sensitize M. tuberculosis to existing antibiotics, potentially:

    • Reducing required antibiotic doses

    • Shortening treatment duration

    • Addressing certain forms of antibiotic tolerance

  • Anti-virulence approaches: If further research confirms a role in pathogenesis, targeting Rv3395c might:

    • Reduce bacterial fitness in the host

    • Modulate host immune responses

    • Complement conventional antibiotic approaches

  • Biomarker development: The temporal expression pattern observed in guinea pig infections suggests potential as a biomarker for:

    • Specific infection stages

    • Treatment response monitoring

    • Distinguishing active from latent infection

What interdisciplinary approaches could provide new insights into Rv3395c biology?

Integrating diverse scientific disciplines could overcome current research limitations:

  • Computational biology and AI:

    • Protein structure prediction using AlphaFold

    • Network analysis to predict functional partners

    • Machine learning to identify patterns in large datasets

  • Chemical biology:

    • Development of chemical probes for Rv3395c

    • Activity-based protein profiling

    • Targeted protein degradation approaches

  • Advanced imaging:

    • Super-resolution microscopy for localization studies

    • Correlative light and electron microscopy

    • Live-cell imaging during infection

  • Systems immunology:

    • Host-pathogen interaction networks

    • Immune cell profiling during infection

    • Cytokine network analysis

By combining these approaches, researchers can develop a more comprehensive understanding of Rv3395c's role in M. tuberculosis biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.