Recombinant Uncharacterized protein Rv3789/MT3897 (Rv3789, MT3897)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Target Names
Rv3789, MT3897
Target Protein Sequence
MRFVVTGGLAGIVDFGLYVVLYKVAGLQVDLSKAISFIVGTITAYLINRRWTFQAEPSTA RFVAVMLLYGITFAVQVGLNHLCLALLHYRAWAIPVAFVIAQGTATVINFIVQRAVIFRI R
Uniprot No.

Q&A

What is Rv3789 and what is its biological significance in Mycobacterium tuberculosis?

Rv3789 is a short transmembrane protein of the GtrA family in Mycobacterium tuberculosis. It plays a critical role in the biosynthesis of the mycobacterial cell wall, specifically in arabinan biosynthesis. The cell wall of M. tuberculosis is principally composed of a mycolyl-arabinogalactan-peptidoglycan complex, which is crucial for survival and virulence of this pathogen . Research demonstrates that Rv3789 functions as an anchor protein that recruits AftA (the first arabinosyltransferase) for arabinogalactan biosynthesis rather than acting as a DPA flippase .

What is the genetic organization and transcriptional regulation of rv3789?

The rv3789 gene is located upstream of the essential dprE1 gene, which encodes a key enzyme in the decaprenyl-phospho-arabinose (DPA) pathway . Transcriptional analysis has revealed that rv3789 and dprE1 are cotranscribed from a common transcription start site situated 64 bp upstream of rv3789 . This genetic organization and cotranscription suggest a functional relationship between these two genes involved in the same biological pathway of arabinan biosynthesis .

What structural characteristics define the Rv3789 protein?

Topology mapping and structural modeling studies have revealed that Rv3789 has:

  • Four transmembrane domains spanning the cytoplasmic membrane

  • A cytoplasmic C-terminus orientation

  • Structural features consistent with models built using sequence coevolution analysis

  • Membrane localization confirmed through GFP fusion experiments

  • Self-association properties suggesting potential dimer or multimer formation

How do rv3789 deletion mutants affect M. tuberculosis phenotype?

Deletion of rv3789 in M. tuberculosis results in several significant phenotypic alterations:

  • Impaired growth compared to wild-type strains

  • Abnormal cell morphology with cells appearing shorter and more swollen than wild-type cells

  • Decreased incorporation of arabinan into arabinogalactan

  • Accumulation of decaprenyl-phospho-arabinose (DPA), the precursor for arabinan synthesis

These phenotypic changes confirm that while rv3789 is not essential for survival, it plays a critical role in normal cell development and cell wall integrity. Complementation studies have verified that reintroduction of the rv3789 gene restores the wild-type phenotype .

What methodologies can be used to generate and validate rv3789 deletion mutants?

Generation of rv3789 deletion mutants employs sophisticated genetic techniques:

  • Homologous recombination using specialized plasmids (e.g., pGKH8) to delete the coding sequence while preserving the natural promoter upstream of dprE1

  • Creation of a conditional knockdown (cKD) strain by:

    • Introducing a complementing copy under tetracycline-pristinamycin control at the attB site

    • Removing the native gene by homologous recombination

    • Testing growth with anhydrotetracycline (ATc) to silence the complementing copy

  • Generation of knockout (KO) strains by replacing the complementing copy with an empty plasmid

Validation methods include:

  • Southern blotting to confirm deletion

  • Colony PCR verification

  • Quantitative PCR to confirm absence of rv3789 expression

  • Phenotypic and biochemical characterization

What protein-protein interactions have been identified for Rv3789?

Protein interaction studies using two-hybrid approaches have revealed several key interactions:

Interaction PartnerExperimental ObservationFunctional Implication
Rv3789 (self)Resistance to 50 μg/ml TMPSelf-association; possible dimer/multimer formation
AftAResistance to 25 μg/ml TMPInteraction with priming arabinosyltransferase
EmbBNo TMP resistanceNo detectable interaction
DprE1/DprE2No interaction detectedNo direct interaction despite genetic proximity

The interaction with AftA is particularly significant as it supports the model that Rv3789 functions as an anchor protein recruiting AftA for arabinan biosynthesis .

How can the membrane topology of Rv3789 be experimentally determined?

Two complementary approaches have been employed to determine Rv3789 topology:

  • GFP fusion approach:

    • C-terminal GFP fusion to visualize localization

    • Fluorescence microscopy showing signal along cell boundaries

    • Confirmation of membrane localization and cytoplasmic C-terminus

    • Verification that GFP fusion maintains protein functionality

  • Beta-lactamase (BlaC) fusion strategy:

    • Full-length Rv3789-BlaC fusion failed to grow on carbenicillin, indicating a cytosolic C-terminus

    • Rv3789ΔCT-BlaC (C-terminal deletion) grew with carbenicillin, suggesting periplasmic orientation of the third helix end

These results consistently demonstrate that Rv3789 is a membrane protein with four transmembrane domains and a cytoplasmic C-terminus .

What is the biochemical relationship between Rv3789 and arabinan biosynthesis?

The relationship between Rv3789 and arabinan biosynthesis is multifaceted:

  • Deletion of rv3789 leads to reduced arabinan content in the cell wall

  • The deletion mutant accumulates decaprenyl-phospho-arabinose (DPA), indicating inefficient utilization of this precursor

  • Rv3789 interacts directly with AftA, the priming arabinosyltransferase that initiates arabinose addition to the galactan backbone

  • The evidence indicates that Rv3789 functions as a scaffold protein recruiting AftA rather than as a DPA flippase

This biochemical role is critical because arabinogalactan is an essential component of the mycobacterial cell wall that contributes to pathogen virulence and survival .

How does the structural model of Rv3789 inform understanding of its function?

Structural modeling of Rv3789 provides key insights into its functional role:

  • The four transmembrane domains anchor the protein in the cytoplasmic membrane, creating a stable platform

  • The cytoplasmic orientation of the C-terminus positions it to interact with cytoplasmic factors

  • This arrangement facilitates the recruitment of AftA and potentially other proteins involved in cell wall biosynthesis

  • The structural organization is evolutionarily conserved, as confirmed by sequence coevolution analysis

The structural model supports the functional characterization of Rv3789 as an anchor protein that localizes the arabinosylation machinery to appropriate sites in the membrane .

What controls should be included when studying rv3789 deletion phenotypes?

When studying rv3789 deletion phenotypes, several essential controls should be implemented:

  • Wild-type strain comparisons for growth and morphology

  • Complementation studies with:

    • Full-length rv3789 to confirm phenotype restoration

    • Fusion proteins to verify functionality despite modifications

  • Merodiploid strains containing both wild-type and mutant alleles

  • Gene silencing using inducible systems (e.g., tetracycline-pristinamycin) to distinguish between essential and non-essential functions

  • Controls for downstream gene expression (particularly dprE1) to rule out polar effects

These controls ensure that observed phenotypes are directly attributable to rv3789 deletion rather than secondary effects.

How can multiple-probe experimental designs be applied to study Rv3789 function?

Multiple-probe experimental designs can be effectively applied to study Rv3789 function:

  • Baseline probes to establish initial expression levels and phenotypes

  • Temporal staggering of probes to maintain experimental design fidelity while tracking skill acquisition

  • Achievement of mastery criteria to demonstrate efficacy of programming

  • Test probes following mastery of trained targets

  • Systematic programming adjustments when mastery is not achieved

This approach allows for rigorous testing of hypotheses about Rv3789 function while maintaining experimental validity in applied settings.

What methodological approaches can resolve conflicting data about Rv3789 function?

When facing conflicting data about Rv3789 function, researchers should employ multiple methodological approaches:

  • Compare results from different model systems:

    • M. tuberculosis (pathogenic, slow-growing)

    • M. smegmatis (non-pathogenic, fast-growing)

    • Reconcile different findings based on model system characteristics

  • Conduct biochemical analyses:

    • Quantitative assessment of cell wall components

    • Analysis of precursor accumulation (e.g., DPA)

    • Structural characterization of arabinogalactan and lipoarabinomannan

  • Employ varied protein interaction methods:

    • Two-hybrid systems

    • Co-immunoprecipitation

    • Cross-linking studies

    • Surface plasmon resonance

  • Utilize advanced imaging techniques:

    • Electron microscopy for ultrastructural analysis

    • Super-resolution microscopy to visualize protein localization

    • Time-lapse microscopy to observe dynamic processes

Integration of these approaches can resolve apparently contradictory findings, as demonstrated in resolving whether Rv3789 functions as a DPA flippase or as an anchor protein .

What are the optimal conditions for expressing recombinant Rv3789 protein?

Optimal expression of recombinant Rv3789 requires consideration of several factors:

  • Expression system selection:

    • E. coli systems for high yield but may require detergent solubilization

    • Mycobacterial expression systems for native-like membrane insertion

    • Cell-free systems for direct incorporation into liposomes

  • Expression construct design:

    • Affinity tags positioned to avoid interference with transmembrane domains

    • Signal sequences appropriate for membrane targeting

    • Codon optimization for the selected expression host

  • Induction and growth conditions:

    • Lower temperatures (16-25°C) to facilitate proper membrane protein folding

    • Mild inducers to prevent toxic accumulation

    • Extended expression periods with monitoring of cell viability

  • Solubilization and purification strategies:

    • Mild detergents (DDM, LMNG) for extraction from membranes

    • Lipid supplementation to maintain native-like environment

    • Size exclusion chromatography to separate monomeric and multimeric forms

These parameters must be empirically optimized for each experimental system.

How can protein-protein interactions between Rv3789 and AftA be quantitatively assessed?

Quantitative assessment of Rv3789-AftA interactions can be performed using several complementary techniques:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified Rv3789 on a sensor chip

    • Flow purified AftA at varying concentrations

    • Measure association and dissociation kinetics

    • Calculate binding affinity (KD) values

  • Microscale Thermophoresis (MST):

    • Label one protein partner (typically the smaller one)

    • Mix with increasing concentrations of unlabeled partner

    • Measure changes in thermophoretic mobility

    • Determine binding constants in solution

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure heat changes during binding

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

    • Calculate stoichiometry and binding constants

  • Fluorescence Resonance Energy Transfer (FRET):

    • Tag Rv3789 and AftA with compatible fluorophores

    • Measure energy transfer as indicator of proximity

    • Perform in native membrane environments or reconstituted systems

These methods provide complementary data on binding affinity, kinetics, and thermodynamics of the Rv3789-AftA interaction.

What arabinan analysis techniques can quantify the effects of rv3789 deletion?

To quantify effects of rv3789 deletion on arabinan content and structure, several analytical techniques can be employed:

  • Cell wall fractionation and purification:

    • Differential extraction of cell wall components

    • Separation of arabinogalactan from other polysaccharides

    • Purification of individual fractions for detailed analysis

  • Compositional analysis:

    • Acid hydrolysis followed by high-performance anion-exchange chromatography

    • Gas chromatography-mass spectrometry of alditol acetates

    • Quantification of arabinose:galactose ratios

  • Structural characterization:

    • NMR spectroscopy to determine linkage patterns

    • Mass spectrometry for branching analysis

    • Enzymatic digestion with specific glycosidases

  • Precursor accumulation:

    • Quantification of decaprenyl-phospho-arabinose (DPA) levels

    • Metabolic labeling with radioactive or fluorescent precursors

    • Thin-layer chromatography or HPLC analysis of lipid-linked precursors

These techniques collectively provide a comprehensive assessment of the biochemical consequences of rv3789 deletion on arabinan biosynthesis.

What aspects of Rv3789 function remain to be elucidated?

Despite significant progress, several aspects of Rv3789 function require further investigation:

  • Detailed structural characterization:

    • High-resolution structure determination by X-ray crystallography or cryo-EM

    • Identification of specific binding domains for AftA interaction

    • Structural basis for self-association

  • Regulatory mechanisms:

    • Factors controlling rv3789-dprE1 co-transcription

    • Post-translational modifications affecting function

    • Response to environmental conditions or stress

  • Complete interaction network:

    • Comprehensive identification of all protein partners

    • Temporal dynamics of interaction during cell wall synthesis

    • Potential interactions with small molecules or lipids

  • In vivo dynamics:

    • Real-time visualization of Rv3789 localization during cell division

    • Spatiotemporal coordination with other cell wall biosynthesis proteins

    • Role in cell wall remodeling during infection

Addressing these questions will provide a more comprehensive understanding of Rv3789's role in mycobacterial biology.

How might Rv3789 be exploited for tuberculosis treatment development?

The critical role of Rv3789 in cell wall biosynthesis suggests several potential avenues for tuberculosis treatment development:

  • Direct targeting strategies:

    • Small molecules disrupting Rv3789-AftA interaction

    • Compounds inducing Rv3789 mislocalization

    • Peptides competing for binding interfaces

  • Combination therapy approaches:

    • Synergistic targeting with existing cell wall biosynthesis inhibitors

    • Compounds increasing sensitivity to current antibiotics by compromising cell wall integrity

    • Multi-target inhibitors affecting both Rv3789 and DprE1

  • Rational drug design:

    • Structure-based design of inhibitors targeting specific domains

    • Fragment-based screening against purified Rv3789

    • In silico docking studies using structural models

  • Diagnostic applications:

    • Biomarkers based on Rv3789 function or expression

    • Imaging agents targeting Rv3789-dependent processes

    • Drug susceptibility testing based on cell wall integrity

These approaches could yield new therapeutic strategies against tuberculosis, particularly for drug-resistant strains where cell wall targets remain important.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.