Recombinant Uncharacterized protein T02E1.7 (T02E1.7)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

T02E1.7 is encoded by the C. elegans gene T02E1.7 (UniProt ID: O45731) and consists of 269 amino acids. Key features include:

PropertyDetails
Expression SystemE. coli (with N-terminal His tag)
Protein LengthFull-length (1-269 aa)
SequenceMDINVVITRCEDYTETLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWG... (truncated)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% Trehalose (pH 8.0)

The recombinant protein is supplied as a lyophilized powder, requiring reconstitution in deionized water or glycerol-containing buffers for stability .

Apoptosis Regulation

T02E1.7 interacts with RNA-binding proteins (e.g., CGH-1, CAR-1) to modulate physiological germ cell apoptosis in C. elegans. Knockdown of T02E1.7 increases oocyte death, suggesting its role in maintaining oogenesis integrity .

RNA Metabolism

The protein associates with mRNA regulatory complexes involved in translational quiescence and stress responses. It influences the stability and localization of mRNAs critical for developmental processes .

Functional Assays

  • Apoptosis Studies: Used to investigate caspase-dependent pathways in C. elegans germline cells .

  • RNA-Protein Interactions: Employed in pull-down assays to identify binding partners like CGH-1 .

Key Research Findings

StudyKey InsightSource
Genetic InteractionT02E1.7 depletion increases germ cell apoptosis by disrupting mRNA metabolism.
Protein-Protein InteractionBinds CGH-1 and CAR-1, forming a complex that regulates oocyte mRNA stability.
Immune Response LinkIndirect association with DKF-2 kinase pathways modulating stress responses.

Limitations and Future Directions

  • Uncharacterized Enzymatic Activity: Despite structural predictions, no catalytic function has been experimentally confirmed .

  • Evolutionary Conservation: Homologs in higher eukaryotes remain unidentified, limiting cross-species extrapolation .

Future studies should prioritize crystallography to resolve its 3D structure and high-throughput screens to map its interactome.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your needs whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
T02E1.7; Uncharacterized protein T02E1.7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T02E1.7
Target Protein Sequence
MDINVVITRCEDYTETLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWG LNYHFSLFLTIVMIINLLFGSLFVMMRYKVTESSAVLGFTIFAQVILYQLYTTYHLLTRN ISIVAAIMLLVAENMLRKPKPANYTQLPRDEHEIEVTSVLLAACRVCLNLMLISMVHFDM SYTRILLCIISYGMMIFVWLGFKTRMMSFMLATWLFAYNIVLNDFWNKDAELHIIRYDFF QTLSAIGGLLLLIHTGPGEFSFDELKKKW
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T02E1.7

STRING: 6239.T02E1.7

UniGene: Cel.16840

Protein Families
SURF4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for producing recombinant T02E1.7?

E. coli has been successfully used as an expression system for recombinant T02E1.7 protein production with an N-terminal His-tag . When selecting an expression system, researchers should consider:

  • For structural studies: E. coli remains the preferred system due to cost-effectiveness and high yield, though proper folding must be verified.

  • For functional studies: Insect cell systems may provide better post-translational modifications than bacterial systems, similar to what has been observed with other recombinant proteins .

  • For interaction studies: Mammalian expression systems might be appropriate if studying potential interactions with mammalian proteins.

When using E. coli, consider optimization of induction temperature, IPTG concentration, and expression duration to maximize soluble protein yield while minimizing inclusion body formation.

What storage and handling conditions are recommended for recombinant T02E1.7?

Recombinant T02E1.7 is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . For working with the protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) and aliquot for long-term storage at -20°C to -80°C.

  • Avoid repeated freeze-thaw cycles as they can damage protein integrity.

  • Working aliquots may be stored at 4°C for up to one week .

The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

How can I verify the proper folding and functionality of recombinant T02E1.7?

Since T02E1.7 is uncharacterized, verifying proper folding requires multiple approaches:

  • Circular Dichroism (CD) spectroscopy: Analyze secondary structure content and compare with computational predictions based on the amino acid sequence.

  • Size Exclusion Chromatography (SEC): Assess aggregation state and conformational homogeneity.

  • Thermal Shift Assays: Determine protein stability under various buffer conditions.

  • Limited proteolysis: Properly folded proteins typically show resistance to protease digestion at specific sites.

  • Active site titration: If enzyme activity is suspected, methods similar to those used for neuraminidase studies could be applied, where active site titrating agents like TR1 can determine the percentage of enzymatically active protein in preparations .

This multi-method approach is particularly important for uncharacterized proteins where functional assays cannot be immediately applied due to unknown activity.

What approaches can help identify potential interaction partners for T02E1.7?

Several complementary techniques can reveal potential protein-protein interactions:

  • Affinity Purification coupled with Mass Spectrometry (AP-MS):

    • Use His-tagged T02E1.7 as bait protein

    • Capture potential binding partners from C. elegans lysates

    • Identify interacting proteins via mass spectrometry

  • Yeast Two-Hybrid (Y2H) screening:

    • Create a fusion construct of T02E1.7 with a DNA-binding domain

    • Screen against a C. elegans cDNA library

    • Validate positive interactions with secondary assays

  • Proximity-dependent Biotin Identification (BioID):

    • Generate a fusion protein of T02E1.7 with a biotin ligase

    • Express in C. elegans or cell culture

    • Identify proximal proteins via streptavidin pulldown and mass spectrometry

  • Co-immunoprecipitation (Co-IP) with targeted candidates:

    • Based on bioinformatic predictions or genetic data

    • Verify interactions using recombinant proteins or in vivo systems

Each method has strengths and limitations, so using multiple approaches increases confidence in identified interactions.

What is the recommended approach for studying T02E1.7 subcellular localization?

To determine the subcellular localization of T02E1.7, consider this methodological workflow:

  • Bioinformatic prediction using tools like TargetP, PSORT, and TMPred to identify potential targeting sequences or transmembrane domains in the T02E1.7 sequence.

  • Fluorescent protein tagging:

    • Generate GFP/mCherry fusion constructs (both N- and C-terminal fusions)

    • Express in C. elegans using tissue-specific promoters

    • Visualize using confocal microscopy

    • Co-localize with established organelle markers

  • Immunohistochemistry:

    • Generate specific antibodies against T02E1.7

    • Perform immunostaining in fixed C. elegans

    • Use counterstains for nuclei (DAPI) and other cellular structures

  • Subcellular fractionation:

    • Isolate organelle fractions from C. elegans tissue

    • Detect T02E1.7 by Western blotting

    • Compare distribution across different cellular compartments

  • Validation through mutation of predicted localization signals to confirm specificity of the observed pattern.

This multi-faceted approach accounts for potential artifacts from any single method.

How can CRISPR-Cas9 be used to study T02E1.7 function in C. elegans?

CRISPR-Cas9 offers powerful approaches for studying T02E1.7 in vivo:

  • Complete knockout:

    • Design gRNAs targeting exonic regions of T02E1.7

    • Introduce frameshift mutations or large deletions

    • Screen for phenotypic consequences

  • Endogenous tagging:

    • Add fluorescent proteins or epitope tags to the C- or N-terminus

    • Maintain native expression levels and patterns

    • Observe localization and expression dynamics in vivo

  • Precise point mutations:

    • Introduce specific amino acid changes to test structure-function hypotheses

    • Target predicted functional domains or post-translational modification sites

  • Promoter replacement:

    • Substitute the native promoter with tissue-specific or inducible promoters

    • Study tissue-specific functions or temporal requirements

  • Conditional alleles:

    • Generate temperature-sensitive or auxin-inducible degron-tagged versions

    • Control protein function or levels temporally

For C. elegans specifically, ensure balanced strains are used if T02E1.7 mutation causes lethality or sterility. The balancer chromosome technologies documented in search result would be particularly useful for maintaining lethal mutations in this gene .

What genetic balancer strategies are appropriate if T02E1.7 mutation causes lethality?

If T02E1.7 mutation produces lethal or sterile phenotypes, genetic balancers provide essential tools for maintaining these mutations:

  • Selection of appropriate balancer:

    • Identify the chromosome containing T02E1.7

    • Choose a balancer that covers that genomic region

    • Consider using established balancers that have been fully characterized at the sequence level

  • Balancer options in C. elegans:

    • Traditional balancers created using physical mutagens like X-ray, UV, or gamma radiation

    • These balancers contain complex genomic rearrangements (CGRs) that suppress recombination

    • Examples include nT1, which is used in over 500 different C. elegans strains in the CGC collection

  • Strain construction methodology:

    • Generate heterozygous animals carrying both the mutation and the balancer

    • Select animals with the balancer-associated phenotypic marker

    • Maintain the strain by picking marked animals each generation

  • Verification process:

    • Confirm presence of mutation through sequencing

    • Verify balancer stability across generations

    • Document any genetic drift or additional mutations

Using established balancers with well-characterized breakpoints, as described in the literature, ensures reliable maintenance of lethal mutations for continued study .

How can RNA interference (RNAi) be used to study T02E1.7 function?

RNAi provides a versatile approach for studying T02E1.7 function, especially useful for preliminary characterization:

  • RNAi construct design:

    • Generate dsRNA targeting specific regions of the T02E1.7 transcript

    • Create vectors for feeding, soaking, or injection delivery methods

    • Consider design of multiple non-overlapping constructs to confirm specificity

  • Delivery methods comparison:

    MethodAdvantagesLimitationsBest Used For
    FeedingHigh-throughput, easyVariable efficiencyInitial screening
    SoakingControlled exposureLabor intensiveSynchronized populations
    InjectionHighest efficiencyTechnical skill requiredStrong knockdown needed
  • Phenotypic analysis:

    • Observe developmental timing, morphology, behavior, lifespan

    • Perform tissue-specific knockdown using strain-specific RNAi

    • Apply stressed conditions to reveal conditional phenotypes

  • Quantification of knockdown:

    • RT-qPCR to measure remaining T02E1.7 transcript levels

    • Western blot to assess protein reduction (requires antibody)

    • Compare with positive controls of known RNAi efficiency

  • RNAi limitations to consider:

    • Incomplete knockdown compared to genetic nulls

    • Potential off-target effects

    • Tissue-specific resistance (especially neurons)

This approach is particularly valuable for initial characterization before investing in more resource-intensive CRISPR-based methods.

What purification strategy is optimal for obtaining high-purity recombinant T02E1.7?

For high-purity T02E1.7 preparation, a multi-step purification strategy is recommended:

  • Initial capture using Immobilized Metal Affinity Chromatography (IMAC):

    • Utilize the N-terminal His-tag present in the recombinant construct

    • Optimize imidazole concentration in binding and elution buffers

    • Consider on-column refolding if protein is primarily in inclusion bodies

  • Secondary purification:

    • Size Exclusion Chromatography (SEC) to separate monomeric protein from aggregates and remove remaining contaminants

    • Ion Exchange Chromatography (IEX) based on the theoretical pI calculated from the amino acid sequence

  • Quality control assessments:

    • SDS-PAGE with Coomassie staining (target >90% purity)

    • Western blotting with anti-His antibodies

    • Mass spectrometry to confirm protein identity and integrity

  • Tag removal consideration:

    • Determine if the His-tag affects functional studies

    • If necessary, incorporate a protease cleavage site and perform on-column cleavage

    • Remove cleaved tag with reverse IMAC

  • Final polishing step:

    • Buffer exchange to remove trace contaminants

    • Concentration to desired levels for downstream applications

This strategy should yield highly pure protein suitable for structural and functional studies.

How can I analyze post-translational modifications of T02E1.7?

Post-translational modifications (PTMs) can significantly impact protein function, making their analysis crucial for understanding T02E1.7:

  • Mass Spectrometry-based approaches:

    • Tryptic digestion followed by LC-MS/MS analysis

    • Use multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage

    • Compare spectra with theoretical masses to identify mass shifts indicative of PTMs

  • PTM-specific enrichment strategies:

    • Phosphopeptide enrichment using TiO2 or IMAC

    • Glycopeptide enrichment using lectin affinity

    • Ubiquitination analysis using K-ε-GG antibodies

  • Site-directed mutagenesis validation:

    • Mutate identified PTM sites to non-modifiable residues

    • Assess functional or structural consequences

    • Compare wild-type and mutant proteins in relevant assays

  • Analysis of expression system impact:

    • Compare PTM profiles between proteins expressed in bacterial systems versus insect or mammalian cells

    • Consider that E. coli-expressed proteins will lack many eukaryotic PTMs, similar to how N-linked glycans are observed in insect cell-produced proteins but not in bacterial systems

  • Computational prediction:

    • Use bioinformatic tools to predict potential PTM sites

    • Compare predictions with experimental findings

    • Analyze evolutionary conservation of PTM sites across species

This comprehensive approach provides detailed insight into the PTM landscape of T02E1.7.

What methods are appropriate for investigating the potential enzymatic activity of T02E1.7?

When investigating potential enzymatic activity of an uncharacterized protein like T02E1.7, a systematic approach is essential:

  • Bioinformatic analysis:

    • Search for conserved catalytic motifs or domains

    • Perform structure prediction and comparison with known enzymes

    • Identify potential active site residues

  • Activity screening panels:

    • Test against diverse substrate libraries (peptides, lipids, carbohydrates)

    • Apply differential scanning fluorimetry with potential substrates/cofactors

    • Monitor changes in thermal stability upon substrate binding

  • Specific activity assays based on structural predictions:

    • If membrane protein features are detected, test for transporter activity

    • If hydrolase motifs are found, screen with fluorogenic substrates

    • Consider coupled enzyme assays for detecting co-factor consumption or product formation

  • Active site titration techniques:

    • Similar to approaches used for neuraminidase, use modified substrate analogs that undergo single turnover events

    • Measure the proportion of active enzyme in the preparation

    • Calculate accurate kinetic parameters like kcat as demonstrated with rNA preparations

  • Site-directed mutagenesis of predicted catalytic residues:

    • Confirm essential residues for activity

    • Establish structure-function relationships

    • Generate catalytically inactive controls

This methodical approach can reveal unexpected enzymatic functions in proteins previously lacking functional annotation.

How can structural biology techniques be applied to understand T02E1.7 function?

Structural biology provides crucial insights into uncharacterized proteins like T02E1.7:

Each method provides complementary information, and integration of multiple approaches yields the most comprehensive structural understanding.

What high-throughput methodologies can reveal T02E1.7's role in cellular pathways?

Several high-throughput approaches can help position T02E1.7 within cellular pathways:

  • Transcriptomics analysis:

    • RNA-Seq comparing wild-type and T02E1.7 knockout/knockdown C. elegans

    • Identify differentially expressed genes and affected pathways

    • Perform at multiple developmental stages for temporal profiling

  • Proteomics strategies:

    • Quantitative proteomics to assess changes in protein abundance after T02E1.7 manipulation

    • Phosphoproteomics to detect signaling pathway alterations

    • Proximity labeling (BioID/TurboID) to map protein interaction neighborhoods

  • Metabolomics approaches:

    • Untargeted metabolite profiling to identify biochemical changes

    • Stable isotope tracing to detect metabolic flux alterations

    • Integration with other omics datasets for pathway mapping

  • High-content phenotypic screening:

    • Automated microscopy to assess morphological changes

    • Behavioral tracking for motility or developmental phenotypes

    • Drug or RNAi modifier screens to identify genetic interactions

  • Comparative interactomics:

    TechniqueInformation ProvidedThroughputSample Requirements
    AP-MSDirect and indirect interactionsMedium-highCellular lysates
    Y2HBinary protein interactionsVery highcDNA library
    BioIDProximity-based interactionsHighIn vivo expression
    Genetic screensFunctional relationshipsVery highMutant collections

Integration of these multi-omics approaches provides a comprehensive view of T02E1.7's functional context.

How can contradictory experimental data about T02E1.7 function be reconciled?

When faced with contradictory data regarding T02E1.7 function, employ these methodological approaches:

  • Systematic analysis of experimental variables:

    • Compare protein constructs used (full-length vs. domains, tag position)

    • Review expression systems and purification methods

    • Assess experimental conditions (buffer composition, temperature, pH)

    • Examine quality control metrics across studies

  • Validation across multiple methodologies:

    • Confirm findings using orthogonal techniques

    • Consider in vitro vs. in vivo disparities

    • Assess differences between acute knockdown and genetic knockout

    • Compare tissue-specific vs. organism-wide manipulations

  • Determining protein quality issues:

    • Analyze the fraction of enzymatically active protein in preparations

    • Consider that domain design can significantly affect functionality, as seen with recombinant neuraminidases where head domain constructs showed ~10-fold higher activity than full ectodomain constructs

    • Assess proper folding through biophysical techniques

  • Contextual dependencies:

    • Investigate developmental stage-specific effects

    • Consider environmental or stress conditions

    • Examine genetic background influences

    • Evaluate tissue-specific functions

  • Reporting and publication bias:

    • Conduct systematic literature review including negative results

    • Contact authors of conflicting studies for unpublished observations

    • Consider pre-registration of experimental designs for future work

This systematic approach transforms contradictory data from an obstacle into an opportunity for deeper understanding of complex protein functions.

How can knowledge about T02E1.7 contribute to understanding human disease mechanisms?

While T02E1.7 is a C. elegans protein, its study may provide insights relevant to human disease:

  • Identification of human orthologs or homologs:

    • Perform thorough sequence and structural comparison analyses

    • Identify conserved domains or motifs between T02E1.7 and human proteins

    • Consider both sequence and functional conservation

  • Modeling of disease-relevant processes:

    • If involved in aging pathways, connect to human age-related disorders

    • If related to tumor growth regulation, explore cancer relevance

    • Consider developmental processes conserved between nematodes and humans

  • Experimental validation in mammalian systems:

    • Express human homologs in T02E1.7 mutant C. elegans for complementation tests

    • Manipulate putative human homologs in cell culture systems

    • Compare phenotypes between systems

  • Translational research strategy:

    • Use C. elegans as a rapid screening platform for drug candidates

    • Develop assays that monitor T02E1.7-dependent processes

    • Validate hits in progressively more complex model systems

  • Integrated data analysis:

    • Cross-reference with human genetic databases and GWAS studies

    • Look for disease associations of human homologs

    • Consider involvement in fundamental cellular processes conserved across species

This approach leverages the experimental advantages of C. elegans while maintaining focus on human health relevance.

How can genetic balancer technologies used in C. elegans inform mammalian genetic manipulation strategies?

Genetic balancer technologies developed for C. elegans offer valuable lessons for mammalian systems:

  • Translatable concepts from C. elegans balancers:

    • Complex genomic rearrangements (CGRs) effectively suppress recombination

    • Chromoanagenesis-like events can be engineered for specific genomic regions

    • Visual markers linked to balancers facilitate tracking

  • Application to mammalian cell line development:

    • Design of synthetic mammalian chromosome balancers

    • Engineering recombination-suppressing inversions in specific genomic regions

    • Development of fluorescent markers linked to balanced regions

  • Methodological considerations:

    • Use of long-read sequencing technologies to characterize complex structural variants

    • Implementation of CRISPR-based approaches to engineer specific rearrangements

    • Validation of balancer stability across multiple cell divisions

  • Comparative advantages and limitations:

    FeatureC. elegans BalancersMammalian Adaptations
    Organism complexityWhole organismCell lines or limited tissue regions
    Engineering methodRadiation-inducedCRISPR-engineered
    Tracking methodVisible phenotypesFluorescent markers
    StabilityMulti-generationalCell passages
  • Future directions:

    • Development of conditional balancing systems in mammals

    • Integration with inducible gene expression systems

    • Application to stem cell-based disease modeling

These translational approaches demonstrate how fundamental genetic tools developed in model organisms can advance mammalian genetics research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.