T02E1.7 is encoded by the C. elegans gene T02E1.7 (UniProt ID: O45731) and consists of 269 amino acids. Key features include:
| Property | Details |
|---|---|
| Expression System | E. coli (with N-terminal His tag) |
| Protein Length | Full-length (1-269 aa) |
| Sequence | MDINVVITRCEDYTETLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWG... (truncated) |
| Purity | >90% (SDS-PAGE verified) |
| Storage | Lyophilized powder in Tris/PBS buffer with 6% Trehalose (pH 8.0) |
The recombinant protein is supplied as a lyophilized powder, requiring reconstitution in deionized water or glycerol-containing buffers for stability .
T02E1.7 interacts with RNA-binding proteins (e.g., CGH-1, CAR-1) to modulate physiological germ cell apoptosis in C. elegans. Knockdown of T02E1.7 increases oocyte death, suggesting its role in maintaining oogenesis integrity .
The protein associates with mRNA regulatory complexes involved in translational quiescence and stress responses. It influences the stability and localization of mRNAs critical for developmental processes .
Apoptosis Studies: Used to investigate caspase-dependent pathways in C. elegans germline cells .
RNA-Protein Interactions: Employed in pull-down assays to identify binding partners like CGH-1 .
Uncharacterized Enzymatic Activity: Despite structural predictions, no catalytic function has been experimentally confirmed .
Evolutionary Conservation: Homologs in higher eukaryotes remain unidentified, limiting cross-species extrapolation .
Future studies should prioritize crystallography to resolve its 3D structure and high-throughput screens to map its interactome.
E. coli has been successfully used as an expression system for recombinant T02E1.7 protein production with an N-terminal His-tag . When selecting an expression system, researchers should consider:
For structural studies: E. coli remains the preferred system due to cost-effectiveness and high yield, though proper folding must be verified.
For functional studies: Insect cell systems may provide better post-translational modifications than bacterial systems, similar to what has been observed with other recombinant proteins .
For interaction studies: Mammalian expression systems might be appropriate if studying potential interactions with mammalian proteins.
When using E. coli, consider optimization of induction temperature, IPTG concentration, and expression duration to maximize soluble protein yield while minimizing inclusion body formation.
Recombinant T02E1.7 is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . For working with the protein:
Briefly centrifuge the vial before opening to bring contents to the bottom.
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
Add glycerol to a final concentration of 5-50% (with 50% being standard) and aliquot for long-term storage at -20°C to -80°C.
Avoid repeated freeze-thaw cycles as they can damage protein integrity.
The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .
Since T02E1.7 is uncharacterized, verifying proper folding requires multiple approaches:
Circular Dichroism (CD) spectroscopy: Analyze secondary structure content and compare with computational predictions based on the amino acid sequence.
Size Exclusion Chromatography (SEC): Assess aggregation state and conformational homogeneity.
Thermal Shift Assays: Determine protein stability under various buffer conditions.
Limited proteolysis: Properly folded proteins typically show resistance to protease digestion at specific sites.
Active site titration: If enzyme activity is suspected, methods similar to those used for neuraminidase studies could be applied, where active site titrating agents like TR1 can determine the percentage of enzymatically active protein in preparations .
This multi-method approach is particularly important for uncharacterized proteins where functional assays cannot be immediately applied due to unknown activity.
Several complementary techniques can reveal potential protein-protein interactions:
Affinity Purification coupled with Mass Spectrometry (AP-MS):
Use His-tagged T02E1.7 as bait protein
Capture potential binding partners from C. elegans lysates
Identify interacting proteins via mass spectrometry
Yeast Two-Hybrid (Y2H) screening:
Create a fusion construct of T02E1.7 with a DNA-binding domain
Screen against a C. elegans cDNA library
Validate positive interactions with secondary assays
Proximity-dependent Biotin Identification (BioID):
Generate a fusion protein of T02E1.7 with a biotin ligase
Express in C. elegans or cell culture
Identify proximal proteins via streptavidin pulldown and mass spectrometry
Co-immunoprecipitation (Co-IP) with targeted candidates:
Based on bioinformatic predictions or genetic data
Verify interactions using recombinant proteins or in vivo systems
Each method has strengths and limitations, so using multiple approaches increases confidence in identified interactions.
To determine the subcellular localization of T02E1.7, consider this methodological workflow:
Bioinformatic prediction using tools like TargetP, PSORT, and TMPred to identify potential targeting sequences or transmembrane domains in the T02E1.7 sequence.
Fluorescent protein tagging:
Generate GFP/mCherry fusion constructs (both N- and C-terminal fusions)
Express in C. elegans using tissue-specific promoters
Visualize using confocal microscopy
Co-localize with established organelle markers
Immunohistochemistry:
Generate specific antibodies against T02E1.7
Perform immunostaining in fixed C. elegans
Use counterstains for nuclei (DAPI) and other cellular structures
Subcellular fractionation:
Isolate organelle fractions from C. elegans tissue
Detect T02E1.7 by Western blotting
Compare distribution across different cellular compartments
Validation through mutation of predicted localization signals to confirm specificity of the observed pattern.
This multi-faceted approach accounts for potential artifacts from any single method.
CRISPR-Cas9 offers powerful approaches for studying T02E1.7 in vivo:
Complete knockout:
Design gRNAs targeting exonic regions of T02E1.7
Introduce frameshift mutations or large deletions
Screen for phenotypic consequences
Endogenous tagging:
Add fluorescent proteins or epitope tags to the C- or N-terminus
Maintain native expression levels and patterns
Observe localization and expression dynamics in vivo
Precise point mutations:
Introduce specific amino acid changes to test structure-function hypotheses
Target predicted functional domains or post-translational modification sites
Promoter replacement:
Substitute the native promoter with tissue-specific or inducible promoters
Study tissue-specific functions or temporal requirements
Conditional alleles:
Generate temperature-sensitive or auxin-inducible degron-tagged versions
Control protein function or levels temporally
For C. elegans specifically, ensure balanced strains are used if T02E1.7 mutation causes lethality or sterility. The balancer chromosome technologies documented in search result would be particularly useful for maintaining lethal mutations in this gene .
If T02E1.7 mutation produces lethal or sterile phenotypes, genetic balancers provide essential tools for maintaining these mutations:
Selection of appropriate balancer:
Balancer options in C. elegans:
Strain construction methodology:
Generate heterozygous animals carrying both the mutation and the balancer
Select animals with the balancer-associated phenotypic marker
Maintain the strain by picking marked animals each generation
Verification process:
Confirm presence of mutation through sequencing
Verify balancer stability across generations
Document any genetic drift or additional mutations
Using established balancers with well-characterized breakpoints, as described in the literature, ensures reliable maintenance of lethal mutations for continued study .
RNAi provides a versatile approach for studying T02E1.7 function, especially useful for preliminary characterization:
RNAi construct design:
Generate dsRNA targeting specific regions of the T02E1.7 transcript
Create vectors for feeding, soaking, or injection delivery methods
Consider design of multiple non-overlapping constructs to confirm specificity
Delivery methods comparison:
| Method | Advantages | Limitations | Best Used For |
|---|---|---|---|
| Feeding | High-throughput, easy | Variable efficiency | Initial screening |
| Soaking | Controlled exposure | Labor intensive | Synchronized populations |
| Injection | Highest efficiency | Technical skill required | Strong knockdown needed |
Phenotypic analysis:
Observe developmental timing, morphology, behavior, lifespan
Perform tissue-specific knockdown using strain-specific RNAi
Apply stressed conditions to reveal conditional phenotypes
Quantification of knockdown:
RT-qPCR to measure remaining T02E1.7 transcript levels
Western blot to assess protein reduction (requires antibody)
Compare with positive controls of known RNAi efficiency
RNAi limitations to consider:
Incomplete knockdown compared to genetic nulls
Potential off-target effects
Tissue-specific resistance (especially neurons)
This approach is particularly valuable for initial characterization before investing in more resource-intensive CRISPR-based methods.
For high-purity T02E1.7 preparation, a multi-step purification strategy is recommended:
Initial capture using Immobilized Metal Affinity Chromatography (IMAC):
Secondary purification:
Size Exclusion Chromatography (SEC) to separate monomeric protein from aggregates and remove remaining contaminants
Ion Exchange Chromatography (IEX) based on the theoretical pI calculated from the amino acid sequence
Quality control assessments:
Tag removal consideration:
Determine if the His-tag affects functional studies
If necessary, incorporate a protease cleavage site and perform on-column cleavage
Remove cleaved tag with reverse IMAC
Final polishing step:
Buffer exchange to remove trace contaminants
Concentration to desired levels for downstream applications
This strategy should yield highly pure protein suitable for structural and functional studies.
Post-translational modifications (PTMs) can significantly impact protein function, making their analysis crucial for understanding T02E1.7:
Mass Spectrometry-based approaches:
Tryptic digestion followed by LC-MS/MS analysis
Use multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage
Compare spectra with theoretical masses to identify mass shifts indicative of PTMs
PTM-specific enrichment strategies:
Phosphopeptide enrichment using TiO2 or IMAC
Glycopeptide enrichment using lectin affinity
Ubiquitination analysis using K-ε-GG antibodies
Site-directed mutagenesis validation:
Mutate identified PTM sites to non-modifiable residues
Assess functional or structural consequences
Compare wild-type and mutant proteins in relevant assays
Analysis of expression system impact:
Computational prediction:
Use bioinformatic tools to predict potential PTM sites
Compare predictions with experimental findings
Analyze evolutionary conservation of PTM sites across species
This comprehensive approach provides detailed insight into the PTM landscape of T02E1.7.
When investigating potential enzymatic activity of an uncharacterized protein like T02E1.7, a systematic approach is essential:
Bioinformatic analysis:
Search for conserved catalytic motifs or domains
Perform structure prediction and comparison with known enzymes
Identify potential active site residues
Activity screening panels:
Test against diverse substrate libraries (peptides, lipids, carbohydrates)
Apply differential scanning fluorimetry with potential substrates/cofactors
Monitor changes in thermal stability upon substrate binding
Specific activity assays based on structural predictions:
If membrane protein features are detected, test for transporter activity
If hydrolase motifs are found, screen with fluorogenic substrates
Consider coupled enzyme assays for detecting co-factor consumption or product formation
Active site titration techniques:
Site-directed mutagenesis of predicted catalytic residues:
Confirm essential residues for activity
Establish structure-function relationships
Generate catalytically inactive controls
This methodical approach can reveal unexpected enzymatic functions in proteins previously lacking functional annotation.
Structural biology provides crucial insights into uncharacterized proteins like T02E1.7:
Each method provides complementary information, and integration of multiple approaches yields the most comprehensive structural understanding.
Several high-throughput approaches can help position T02E1.7 within cellular pathways:
Transcriptomics analysis:
RNA-Seq comparing wild-type and T02E1.7 knockout/knockdown C. elegans
Identify differentially expressed genes and affected pathways
Perform at multiple developmental stages for temporal profiling
Proteomics strategies:
Quantitative proteomics to assess changes in protein abundance after T02E1.7 manipulation
Phosphoproteomics to detect signaling pathway alterations
Proximity labeling (BioID/TurboID) to map protein interaction neighborhoods
Metabolomics approaches:
Untargeted metabolite profiling to identify biochemical changes
Stable isotope tracing to detect metabolic flux alterations
Integration with other omics datasets for pathway mapping
High-content phenotypic screening:
Automated microscopy to assess morphological changes
Behavioral tracking for motility or developmental phenotypes
Drug or RNAi modifier screens to identify genetic interactions
Comparative interactomics:
| Technique | Information Provided | Throughput | Sample Requirements |
|---|---|---|---|
| AP-MS | Direct and indirect interactions | Medium-high | Cellular lysates |
| Y2H | Binary protein interactions | Very high | cDNA library |
| BioID | Proximity-based interactions | High | In vivo expression |
| Genetic screens | Functional relationships | Very high | Mutant collections |
Integration of these multi-omics approaches provides a comprehensive view of T02E1.7's functional context.
When faced with contradictory data regarding T02E1.7 function, employ these methodological approaches:
Systematic analysis of experimental variables:
Compare protein constructs used (full-length vs. domains, tag position)
Review expression systems and purification methods
Assess experimental conditions (buffer composition, temperature, pH)
Examine quality control metrics across studies
Validation across multiple methodologies:
Confirm findings using orthogonal techniques
Consider in vitro vs. in vivo disparities
Assess differences between acute knockdown and genetic knockout
Compare tissue-specific vs. organism-wide manipulations
Determining protein quality issues:
Analyze the fraction of enzymatically active protein in preparations
Consider that domain design can significantly affect functionality, as seen with recombinant neuraminidases where head domain constructs showed ~10-fold higher activity than full ectodomain constructs
Assess proper folding through biophysical techniques
Contextual dependencies:
Investigate developmental stage-specific effects
Consider environmental or stress conditions
Examine genetic background influences
Evaluate tissue-specific functions
Reporting and publication bias:
Conduct systematic literature review including negative results
Contact authors of conflicting studies for unpublished observations
Consider pre-registration of experimental designs for future work
This systematic approach transforms contradictory data from an obstacle into an opportunity for deeper understanding of complex protein functions.
While T02E1.7 is a C. elegans protein, its study may provide insights relevant to human disease:
Identification of human orthologs or homologs:
Perform thorough sequence and structural comparison analyses
Identify conserved domains or motifs between T02E1.7 and human proteins
Consider both sequence and functional conservation
Modeling of disease-relevant processes:
Experimental validation in mammalian systems:
Express human homologs in T02E1.7 mutant C. elegans for complementation tests
Manipulate putative human homologs in cell culture systems
Compare phenotypes between systems
Translational research strategy:
Use C. elegans as a rapid screening platform for drug candidates
Develop assays that monitor T02E1.7-dependent processes
Validate hits in progressively more complex model systems
Integrated data analysis:
Cross-reference with human genetic databases and GWAS studies
Look for disease associations of human homologs
Consider involvement in fundamental cellular processes conserved across species
This approach leverages the experimental advantages of C. elegans while maintaining focus on human health relevance.
Genetic balancer technologies developed for C. elegans offer valuable lessons for mammalian systems:
Translatable concepts from C. elegans balancers:
Application to mammalian cell line development:
Design of synthetic mammalian chromosome balancers
Engineering recombination-suppressing inversions in specific genomic regions
Development of fluorescent markers linked to balanced regions
Methodological considerations:
Comparative advantages and limitations:
| Feature | C. elegans Balancers | Mammalian Adaptations |
|---|---|---|
| Organism complexity | Whole organism | Cell lines or limited tissue regions |
| Engineering method | Radiation-induced | CRISPR-engineered |
| Tracking method | Visible phenotypes | Fluorescent markers |
| Stability | Multi-generational | Cell passages |
Future directions:
Development of conditional balancing systems in mammals
Integration with inducible gene expression systems
Application to stem cell-based disease modeling
These translational approaches demonstrate how fundamental genetic tools developed in model organisms can advance mammalian genetics research.