Recombinant Uncharacterized protein T09E8.3 (T09E8.3)

Shipped with Ice Packs
In Stock

Description

Characteristics of T09E8.3

Physical and Chemical Properties

  • Protein Type: Transmembrane protein

  • Storage Conditions: Recommended storage at -20°C or -80°C for extended periods; avoid repeated freeze-thaw cycles.

  • Buffer Composition: Tris-based buffer with 50% glycerol.

  • Tag Information: N-terminal 10xHis-tagged for purification purposes.

Sequence Information

The amino acid sequence provides insights into potential structural features and functional domains of the protein, although specific functions have yet to be elucidated.

Research Findings Related to T09E8.3

Expression and Purification

The recombinant T09E8.3 protein is produced using an E. coli expression system, which allows for large-scale production necessary for biochemical studies. The expression region spans the first 145 amino acids of the protein.

Functional Studies

Despite being labeled as uncharacterized, ongoing research aims to determine the biological role of T09E8.3 in Caenorhabditis elegans. Studies involving similar uncharacterized proteins suggest that they may play critical roles in cellular processes such as signal transduction, metabolic pathways, or stress responses.

Potential Applications

Biomedical Research

Understanding the function of T09E8.3 could have implications in various fields, including:

  • Genomics: Insights into gene function and regulation.

  • Proteomics: Contribution to the understanding of protein interactions and networks.

  • Therapeutics: Potential identification of novel drug targets based on the protein's role in cellular mechanisms.

Future Directions

Further research is necessary to elucidate the specific functions and mechanisms of action associated with Recombinant Uncharacterized Protein T09E8.3. Techniques such as mass spectrometry, crystallography, and advanced bioinformatics could be employed to gain deeper insights into its structure-function relationships.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cni-1; cnih-2; T09E8.3; Protein cornichon homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
cni-1
Target Protein Sequence
MAFTFAAFCYLLALIAVGFCIFFAIYTVICVDELRTDYKNPIEQCRNLNQLILPEYIIHG TFTVLFIFSWQLISILANLPLAFYHIYTYAKRPVMSGPGIYDPTTILNRSTLSSTLRISW IKLAFYLVSFFYYLYAMIYTLVTSN
Uniprot No.

Target Background

Function

Negatively regulates the export of glr-1 from the endoplasmic reticulum to synapses.

Database Links

KEGG: cel:CELE_T09E8.3

STRING: 6239.T09E8.3.2

UniGene: Cel.8265

Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell junction, synapse. Cell projection, dendrite.
Tissue Specificity
Widely expressed in the nervous system including in the AVA interneurons.

Q&A

What is Recombinant Uncharacterized protein T09E8.3 and what are its key identifiers?

Recombinant Uncharacterized protein T09E8.3 (T09E8.3) is a transmembrane protein from Caenorhabditis elegans that functions as a cornichon homolog. The protein is officially designated as cni-1 and can be identified through several database references:

DatabaseIdentifier
UniProtQ22361
KEGGcel:CELE_T09E8.3
STRING6239.T09E8.3.2
UniGeneCel.8265

The full-length protein consists of 145 amino acids and typically contains an N-terminal 10×His tag when produced recombinantly . This protein is part of the cornichon family of proteins that regulate membrane protein trafficking, particularly for neurotransmitter receptors.

What is the biological function of T09E8.3 protein in C. elegans?

T09E8.3 (cni-1) functions as a cornichon homolog that regulates the export of glutamate receptor GLR-1 from the endoplasmic reticulum (ER) to synapses in C. elegans. The protein negatively modulates ER-to-Golgi trafficking by interacting with cargo receptors, effectively acting as a regulatory checkpoint in the secretory pathway.

RNA interference (RNAi) studies have demonstrated that silencing cni-1 in C. elegans leads to observable phenotypes including sterility and uncoordinated movement, highlighting its importance in neuromuscular function and reproduction . These phenotypes suggest broader physiological roles beyond glutamate receptor trafficking, potentially affecting multiple cellular systems in the nematode .

What expression systems are recommended for producing Recombinant T09E8.3?

Several expression systems can be utilized for producing Recombinant T09E8.3, each with specific advantages depending on research requirements:

Host SystemAdvantagesConsiderations
Escherichia coliHigher yields, faster production, cost-effectiveMay lack post-translational modifications
YeastEukaryotic processing, moderate yieldsLonger production time than E. coli
BaculovirusSuperior for transmembrane proteins, proper foldingMore complex setup, higher cost
Mammalian cell systemsClosest to native modifications, optimal foldingLowest yields, highest cost, longest timeline

For T09E8.3 specifically, E. coli expression systems utilizing T7 promoter vectors have shown enhanced yield and solubility for this transmembrane protein. The choice of expression system should be guided by the intended application, with E. coli being suitable for structural studies and mammalian systems preferred when native conformation is critical .

For optimal expression in E. coli, the protein is typically produced with an N-terminal 10×His tag to facilitate purification while minimizing interference with protein function .

What are the recommended storage conditions for maintaining T09E8.3 stability?

Proper storage is critical for maintaining the structural integrity and functional activity of Recombinant T09E8.3:

Storage PurposeTemperatureDurationBuffer Conditions
Long-term storage-20°C to -80°C6-12 monthsTris-based buffer, 50% glycerol
Working aliquots4°C≤1 weekOptimized for protein stability

Important considerations include:

  • Repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity

  • For extended storage, it is advisable to conserve the protein at -20°C or -80°C

  • The shelf life of lyophilized forms (12 months) is typically longer than liquid forms (6 months)

  • Working aliquots should be prepared to minimize freeze-thaw cycles

Storage buffer composition significantly impacts stability, with Tris-based buffers containing 50% glycerol being common for this protein . The specific buffer formulation is typically optimized during the production process to enhance long-term stability .

How can RNAi be used to study phenotypes associated with T09E8.3 knockdown?

RNA interference (RNAi) provides a powerful approach for studying T09E8.3 function in C. elegans through targeted gene silencing. There are three primary methods for RNAi delivery, each with specific applications:

RNAi MethodProtocol OverviewAdvantagesLimitations
InjectionDirect injection of dsRNA into gonadHighest efficiency, rapid onsetTechnically demanding, limited throughput
SoakingImmersion of worms in dsRNA solutionModerate efficiency, simple setupVariable penetrance
FeedingBacteria expressing dsRNA as food sourceHigh throughput, simple implementationSlower onset, tissue-dependent efficiency

For studying T09E8.3 specifically, the feeding method has been effectively employed to investigate sterility and uncoordinated movement phenotypes . The procedure typically involves:

  • Preparing bacteria containing a plasmid with T09E8.3-specific sequence

  • Growing transformed bacteria on IPTG-containing media to induce dsRNA expression

  • Transferring synchronized L1 or L4 stage worms to RNAi plates

  • Observing phenotypes after 24-72 hours

For enhanced RNAi sensitivity, the rrf-3 strain is recommended as it demonstrates hypersensitivity to RNAi compared to standard N2 wild-type worms . Phenotypic assessment should include:

  • Quantitative thrashing assays to measure uncoordinated movement

  • Brood size quantification to assess sterility

  • High-resolution imaging of the gonad for morphological defects

What techniques are most effective for studying T09E8.3's role in protein trafficking?

As a cornichon homolog that regulates glutamate receptor trafficking, T09E8.3 can be studied using several specialized techniques:

  • Fluorescent protein tagging and live imaging

    • Tagging GLR-1 with GFP or other fluorescent proteins

    • Time-lapse imaging to track receptor movement from ER to synapses

    • FRAP (Fluorescence Recovery After Photobleaching) to measure trafficking kinetics

  • Coimmunoprecipitation assays

    • Using recombinant T09E8.3 with His-tag to pull down interacting partners

    • Western blotting to detect specific cargo receptors and adaptors

    • Mass spectrometry to identify novel interacting proteins

  • Subcellular fractionation

    • Isolating different cellular compartments (ER, Golgi, plasma membrane)

    • Quantifying GLR-1 distribution across fractions in wild-type vs. T09E8.3 mutants

    • Detecting changes in trafficking intermediates

  • Electron microscopy

    • Visualizing ultrastructural changes in secretory pathway organization

    • Immunogold labeling to localize T09E8.3 and GLR-1 at the ER-Golgi interface

    • Tomography to reconstruct 3D architecture of trafficking compartments

These approaches can be combined with genetic manipulation (RNAi or CRISPR) to create loss-of-function or gain-of-function conditions for T09E8.3, allowing functional assessment of its role in glutamate receptor export .

How can Recombinant T09E8.3 be used for antibody production and validation?

Recombinant T09E8.3 serves as an excellent immunogen for generating antibodies against cornichon homologs, following this general methodology:

  • Antibody generation protocol:

    • Immunize rabbits or other suitable hosts with purified recombinant T09E8.3 (≥85% purity)

    • Boost immunization at 2-3 week intervals (typically 3-4 boosts)

    • Collect serum and purify antibodies using affinity chromatography

    • Validate specificity using western blotting against wild-type and knockout samples

  • Validation methods for antibody quality assessment:

    • Western blotting against recombinant protein and native extracts

    • Immunoprecipitation efficiency testing

    • Immunohistochemistry in wild-type vs. RNAi-treated tissues

    • Pre-absorption controls with recombinant protein

  • Applications of validated antibodies:

    • Tracking endogenous T09E8.3 expression patterns in different tissues

    • Investigating protein-protein interactions via co-immunoprecipitation

    • Analyzing subcellular localization through immunofluorescence microscopy

The high purity (≥85%) of the recombinant protein, verified by SDS-PAGE, is critical for producing antibodies with minimal cross-reactivity. Researchers should consider epitope selection carefully, as the transmembrane nature of T09E8.3 may make certain regions less immunogenic or inaccessible in intact cells.

What experimental design principles should be applied when studying T09E8.3 function?

When designing experiments to investigate T09E8.3 function, researchers should adhere to these key principles:

  • Control selection

    • Include both positive and negative controls in each experiment

    • Use well-characterized cornichon homologs from other species as functional references

    • Implement non-targeting RNAi controls when performing knockdown studies

  • Temperature considerations

    • Maintain consistent temperature conditions (typically 20°C) for C. elegans culture

    • For temperature-sensitive experiments, consider using 20°C as permissive, 23.5°C as semi-permissive, and 25°C as restrictive temperatures

    • Record and report all temperature parameters in methodology sections

  • Replication requirements

    • Perform experiments with a minimum of 3 biological replicates

    • Include sufficient technical replicates to account for variability

    • Perform power analysis to determine appropriate sample sizes

  • Variables to control:

    • Age of worms (use synchronized populations)

    • Culture conditions (media composition, bacterial food source)

    • Environmental factors (humidity, light cycles)

    • Genetic background (use isogenic strains)

  • Phenotypic assessment standardization:

    • Develop quantitative metrics for uncoordinated movement (e.g., thrashing assays)

    • Standardize imaging parameters for morphological analysis

    • Implement blinded scoring to eliminate observer bias

Proper experimental design ensures reproducibility and validity of findings regarding T09E8.3 function in glutamate receptor trafficking and related phenotypes.

How does T09E8.3 compare to cornichon homologs in other species?

T09E8.3 (cni-1) is part of the evolutionarily conserved cornichon family of proteins that regulate receptor trafficking. A comparative analysis reveals important similarities and differences:

SpeciesHomologKey FunctionsSequence Similarity
C. elegansT09E8.3 (cni-1)GLR-1 receptor trafficking, ER export regulationReference sequence
DrosophilaCornichon (cni)Gurken signaling, EGFR pathway regulationModerate similarity
MammalsCNIH1-4AMPA receptor trafficking, synaptic functionHigh similarity in functional domains
YeastErv14pER export of transmembrane proteinsLowest similarity, functional conservation

The conservation pattern suggests fundamental roles in secretory pathway regulation across eukaryotes, with specialization for specific cargo proteins in different organisms. In mammals, CNIH proteins regulate AMPA receptor trafficking similar to how T09E8.3 regulates GLR-1 in C. elegans.

Key comparative insights:

  • The transmembrane topology is highly conserved across species

  • The cargo recognition domains show species-specific adaptations

  • The regulatory mechanisms for ER export appear to be a universal function

This evolutionary conservation makes T09E8.3 an excellent model for studying fundamental principles of membrane protein trafficking that may apply across species.

What are the best practices for optimizing expression and purification of transmembrane proteins like T09E8.3?

Transmembrane proteins like T09E8.3 present unique challenges for recombinant expression and purification. The following optimized protocol is recommended:

  • Expression system selection:

    • For structural studies: E. coli with specialized strains (C41/C43)

    • For functional studies: Insect or mammalian cells

    • For high-throughput screening: Cell-free expression systems

  • Vector design optimization:

    • Use T7 promoter-based vectors for E. coli expression

    • Include solubility-enhancing fusion partners (MBP, SUMO)

    • Design constructs with removable tags via specific protease sites

    • Consider codon optimization for the expression host

  • Expression conditions:

    • Induce at lower temperatures (16-18°C) to enhance proper folding

    • Use specialized media formulations (e.g., Terrific Broth)

    • Optimize induction timing and inducer concentration

    • Consider co-expression with chaperones

  • Purification strategy:

    • Two-step purification minimum (IMAC followed by size exclusion)

    • Use mild detergents for extraction (DDM, LMNG)

    • Include glycerol in all buffers (typically 10-20%)

    • Maintain constant pH and ionic strength throughout purification

  • Quality control assessments:

    • SDS-PAGE to verify purity (target ≥85%)

    • Western blotting to confirm identity

    • Size exclusion chromatography to assess homogeneity

    • Functional assays to verify activity post-purification

Following these best practices significantly improves the yield and quality of recombinant T09E8.3, making it suitable for downstream applications including structural studies, interaction assays, and antibody production.

What are common challenges in working with Recombinant T09E8.3 and how can they be addressed?

Researchers working with Recombinant T09E8.3 frequently encounter several challenges. Here are methodological solutions to these common issues:

ChallengePotential CausesSolution Approach
Low expression yieldToxicity to host cells, inefficient translationUse lower induction temperatures (16-18°C), reduce inducer concentration, try different host strains (C41/C43 for E. coli)
Protein aggregationImproper folding, detergent incompatibilityScreen multiple detergents, add stabilizing agents (glycerol, specific lipids), optimize buffer composition
Degradation during storageProtease contamination, freeze-thaw cyclesAdd protease inhibitors, store in smaller aliquots, optimize glycerol concentration (50%)
Poor antibody recognitionConformational epitopes, tag interferenceGenerate antibodies against multiple regions, use different tag positions or cleavable tags
Inconsistent RNAi resultsStrain variation, environmental factorsUse rrf-3 hypersensitive strain, standardize culture conditions, increase sample size

For transmembrane proteins like T09E8.3, maintaining native-like membrane environments is particularly critical. Consider incorporating nanodiscs or amphipols in late-stage purification to enhance stability and functional relevance for interaction studies.

When troubleshooting expression issues, a systematic approach testing multiple conditions in parallel (expression temperature, host strain, induction conditions) is recommended to identify optimal parameters for this challenging protein class.

How can researchers reconcile contradictory findings about T09E8.3 function?

When faced with contradictory findings regarding T09E8.3 function, researchers should implement a systematic analysis approach:

  • Methodological comparison:

    • Evaluate differences in experimental techniques (RNAi vs. genetic knockout)

    • Compare protein expression systems used (prokaryotic vs. eukaryotic)

    • Assess differences in assay sensitivity and specificity

  • Genetic background analysis:

    • Determine if strain differences contribute to phenotypic variation

    • Check for the presence of suppressor mutations

    • Consider the influence of epigenetic factors

  • Environmental variable assessment:

    • Compare temperature conditions across studies (20°C standard vs. variable)

    • Evaluate differences in culture media composition

    • Consider developmental timing of interventions

  • Statistical rigor evaluation:

    • Reassess sample sizes and power calculations

    • Compare statistical methods used for analysis

    • Consider reporting biases that may influence published findings

  • Reconciliation experiments:

    • Design studies specifically to address contradictions

    • Perform side-by-side comparisons under identical conditions

    • Consider collaboration with labs reporting conflicting results

The field of protein trafficking research often produces seemingly contradictory results that may represent context-dependent functions rather than true contradictions. T09E8.3's role may vary based on developmental stage, tissue type, or environmental conditions, explaining some apparent discrepancies in the literature .

What are promising new approaches for investigating T09E8.3 function?

Emerging technologies offer new opportunities to advance our understanding of T09E8.3 function:

  • CRISPR/Cas9 genome editing

    • Generation of precise point mutations in functional domains

    • Creation of fluorescent knock-in strains for live imaging

    • Development of conditional knockout models using auxin-inducible degron technology

  • Cryo-electron microscopy

    • Structural determination of T09E8.3 alone and in complex with GLR-1

    • Visualization of trafficking intermediates at molecular resolution

    • Mapping of binding interfaces with cargo adaptors

  • Proximity labeling proteomics

    • BioID or APEX2 fusion to T09E8.3 to identify transient interactors

    • Tissue-specific and temporally controlled labeling

    • Comparative interactomes under different conditions

  • Super-resolution microscopy

    • Nanoscale visualization of T09E8.3 distribution in the ER-Golgi interface

    • Single-particle tracking of receptor trafficking events

    • Multicolor imaging to map trafficking complexes

  • Computational approaches

    • Molecular dynamics simulations of T09E8.3-membrane interactions

    • AI-powered prediction of functional domains and interaction sites

    • Systems biology modeling of trafficking pathway regulation

These advanced approaches will help resolve outstanding questions about T09E8.3's precise mechanism of action in regulating glutamate receptor trafficking and potentially reveal new functions beyond current understanding .

How might studies of T09E8.3 inform broader understanding of trafficking disorders?

Research on T09E8.3 has significant translational potential for understanding human trafficking disorders:

  • Neurodevelopmental conditions

    • The role of T09E8.3 in glutamate receptor trafficking parallels processes disrupted in conditions like autism and schizophrenia

    • Understanding regulatory mechanisms may suggest therapeutic targets for these disorders

    • C. elegans models offer high-throughput platforms for drug screening

  • Secretory pathway diseases

    • Fundamental insights from T09E8.3 studies apply to conditions involving ER-Golgi trafficking defects

    • Conserved cornichon functions suggest mechanistic commonalities across species

    • Potential applications in understanding conditions like congenital disorders of glycosylation

  • Cancer biology connections

    • Altered trafficking of growth factor receptors is a hallmark of many cancers

    • Understanding fundamental regulation by cornichon proteins may suggest novel intervention points

    • Potential development of trafficking-targeted therapeutics

The high degree of conservation between C. elegans cni-1 (T09E8.3) and human cornichon homologs makes these studies particularly valuable for translational research. The genetic tractability of C. elegans allows for rapid testing of hypotheses that can later be validated in mammalian systems, accelerating the path from basic mechanistic understanding to clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.