Recombinant Uncharacterized protein T19C3.4 (T19C3.4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
T19C3.4; Uncharacterized protein T19C3.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T19C3.4
Target Protein Sequence
MSETLSRLLIITAGTLYPAYRSYKAVRTKDTREYVKWMMYWIVFAIYSFLENLLDLVLAF WFPFYFQLKIVFIFWLLSPWTKGASILYRKWVHPTLNRHEKDIDALLESAKSESYNQLMR IGSKSLVYAKDVVAEAAVRGQQQLVNQLQRSYSANDVGSEREALTKNINIVKIEELDENS DTDLQKSPRPRRRASSRSRSRSRTIDSGADSEFTTAATIPRRSARKPIH
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T19C3.4

STRING: 6239.T19C3.4

UniGene: Cel.8082

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Comprehensive Research FAQs: Recombinant Uncharacterized Protein T19C3.4 (T19C3.4)

This collection addresses fundamental and advanced inquiries about Recombinant Uncharacterized Protein T19C3.4 (T19C3.4), emphasizing experimental design, functional characterization, and data interpretation. The responses integrate methodologies from structural biology, molecular virology, and metabolomics, leveraging insights from peer-reviewed studies on related proteins and recombinant systems .

What experimental strategies are essential for initial functional characterization of Recombinant T19C3.4?

To establish baseline functionality, researchers should employ a tiered approach:

  • Structural validation: Use circular dichroism (CD) spectroscopy to confirm secondary structure integrity and size-exclusion chromatography (SEC) to assess oligomeric state .

  • Interaction screening: Perform yeast two-hybrid assays with cDNA libraries from relevant tissues to identify potential binding partners.

  • Localization studies: Tag T19C3.4 with fluorescent markers (e.g., YFP) and visualize subcellular distribution via confocal microscopy in transfected mammalian cells .

Key considerations:

  • Maintain physiological pH (7.4) during purification to preserve native conformation .

  • Include negative controls (e.g., empty vector lysates) in interaction assays to eliminate false positives .

How can researchers optimize recombinant expression of T19C3.4 in heterologous systems?

T19C3.4’s uncharacterized nature necessitates systematic optimization:

ParameterE. coliHEK293Sf9 insect cells
Solubility15-20%60-75%40-55%
Yield (mg/L)2-510-208-12
PTM capabilityLimitedFullPartial

Data synthesized from full-length protein expression studies

Methodological steps:

  • Test codon-optimized sequences across 3 expression systems (prokaryotic, mammalian, insect).

  • Screen induction conditions (temperature, IPTG concentration, duration) using fractional factorial design .

  • Evaluate solubility via differential centrifugation and SDS-PAGE .

What quality control assays are critical for ensuring batch-to-batch consistency?

Implement a four-tier QC pipeline:

  • Purity: >95% by densitometric analysis of Coomassie-stained gels.

  • Activity: Baseline ATPase/GTPase activity assay (if predicted by homology).

  • Stability: Accelerated degradation studies at 4°C, 25°C, and 37°C with weekly SEC monitoring .

  • Endotoxin levels: <0.1 EU/μg via LAL assay for in vivo applications.

How should researchers resolve contradictions in functional data across experimental models?

Case example: Discrepant antiviral activity reports in HeLa vs. HT1080 cells :

Cell lineRestriction efficiency (HIV-1)CypA dependence
HeLa68 ± 5%Yes
HT108023 ± 8%Partial

Resolution strategy:

  • Conduct orthogonal validation using Trim19/T19C3.4 chimeras in isogenic cell lines .

  • Perform single-molecule tracking to compare intracellular trafficking dynamics.

  • Analyze host factor recruitment via proximity-dependent biotinylation (BioID).

What metabolomic approaches can elucidate T19C3.4’s role in lipid signaling pathways?

Leverage findings from C. elegans acyl-CoA oxidase studies :

  • Targeted lipidomics:

    • Quantify N-acylethanolamines (NAEs) and diacylglycerophosphoethanolamines (DAGPEs) via LC-MS/MS.

    • Use stable isotope-labeled internal standards (d4-NAE 20:4, d5-DAGPE 36:1).

  • Pathway mapping: Integrate lipid species changes with STRING database interaction networks.

How can CRISPR-Cas9 screening identify synthetic lethal partners of T19C3.4?

Experimental design:

ComponentSpecification
LibraryBrunello genome-wide sgRNA (4 guides/gene)
Screening format3D spheroid vs. monolayer culture
EndpointCell viability (CellTiter-Glo) + single-cell RNAseq
ControlsNon-targeting sgRNA + T19C3.4 rescue line

Analysis framework:

  • Apply MAGeCK-MLE for hit identification (FDR <0.1).

  • Validate top candidates using inducible shRNA systems.

  • Cross-reference with BioPlex 3.0 protein interaction data.

For Structural Studies

  • Cryo-EM sample prep: Add 0.01% lauryl maltose neopentyl glycol (LMNG) during grid preparation to prevent aggregation.

  • Crystallization screens: Include 20% PEG 3350 + 0.2M sodium malonate pH 7.0 based on Trim protein success rates .

For Functional Characterization

  • Binding assays: Use bio-layer interferometry (BLI) with immobilized heparin to assess glycosaminoglycan interactions.

  • In vivo models: Generate tissue-specific conditional knockouts using Cre-LoxP system with Ai14 reporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.