Recombinant Uncharacterized protein T25E4.2 (T25E4.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type if needed, and we will prioritize its implementation.
Synonyms
T25E4.2; Uncharacterized protein T25E4.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-471
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T25E4.2
Target Protein Sequence
MKPGFKDLRAVGYQTDVPYVSLSNYCWSFNCPKPGAEVEFLNMTFQLMNSTATIVQIDAD IEQSIDMVSNGSADITLVSARQTLDRMKKVDFTTPIGFVYYGYLVREIPELAVADYIMRL FDYDTLAILISFGLIIGALLYLYTWIFGLRVRSLLDWMFISCSGIIHQFMFRISSPICAL VLIGFWLLCCLVIITYYEAKLKSFLLLSHHRGTIFNTLDGVLEAAEHKGWTLVIQERGYT PYLYCNPSQCARLDRLKSRFRFISLSLTDCSFLFRINFIGADDDANLLLGQDKHVGFSAL ASDLAETDITYFDYHSKILFVRDKIMAPEYLAYAVNKNVKGLREKFNRAVAYTKSGYGTV RSRYIASFPSYNSVTSQSQTITVLQTSHFIQLYKFCFIFYGIAIIVFILEIIFHRMTKNF TFFGHSYNYHLSGFEWRFARPKWIHFPRRNTVILPLSKSYSPDNERRVTVC
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T25E4.2

STRING: 6239.T25E4.2

UniGene: Cel.27829

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the T25E4.2 protein in C. elegans?

T25E4.2 is an uncharacterized protein in C. elegans that lacks comprehensive functional annotation. While specific information about T25E4.2 is limited, it follows the naming convention typical of C. elegans genes, indicating its genomic location. Like many nematode proteins, understanding its function requires experimental characterization through techniques such as GFP tagging, gene knockout studies, and expression analysis. Researchers typically begin characterization by examining protein domains, sequence homology, and predicted structures to formulate initial hypotheses about function .

What expression vectors are most suitable for recombinant T25E4.2 production?

For C. elegans proteins like T25E4.2, the pPD series of GFP expression vectors (particularly pPD95.75, pPD95.77, pPD95.79, and pPD95.81) developed by Andrew Fire has proven highly effective for expression studies. When creating constructs, researchers should consider whether to make full-length or partial GFP fusions, as this can significantly impact fluorescence intensity. For maximum fluorescence while maintaining functional domains, partial fusions that include important regulatory introns are often optimal . The choice between full-length and partial fusion should be guided by the specific experimental goals and the protein's predicted structure.

How can I determine the expression pattern of T25E4.2 in C. elegans?

The most reliable approach for determining the expression pattern of T25E4.2 is to create transcriptional or translational GFP reporter constructs. The process typically involves PCR amplification of several kilobases (5-15kb) of the genomic region containing the gene and its regulatory elements, followed by subcloning into a suitable GFP expression vector like pPD95.77. The construct can then be microinjected into C. elegans along with a co-injection marker like lin-15 rescue plasmid (pJM23) to generate transgenic lines . Multiple independent extragenic lines should be examined to account for expression variability. Confocal microscopy of transgenic worms at different developmental stages will reveal the spatiotemporal expression pattern.

How can I determine if T25E4.2 undergoes autoregulation similar to TBX-2?

To investigate potential autoregulation of T25E4.2, you should first identify candidate binding sites in its promoter region using position frequency matrix scanning tools such as MotifFinder in WormBase or the Uniprobe database. After identifying potential binding sites, perform chromatin immunoprecipitation (ChIP) experiments using a GFP-tagged version of T25E4.2 (similar to the TBX-2::GFP fusion described in search result 2). Compare DNA enrichment between samples immunoprecipitated with anti-GFP antibody versus nonspecific IgG . You should also perform control ChIPs in wild-type animals lacking the T25E4.2::GFP fusion. Additionally, create reporter constructs with mutated binding sites to validate the functional significance of any identified sites. Quantitative RT-PCR can be used to measure whether T25E4.2 mRNA levels increase in T25E4.2 mutants, which would further support autoregulation.

What approaches can be used to characterize potential post-translational modifications of T25E4.2?

Post-translational modifications (PTMs) can significantly impact protein function. For T25E4.2, a multi-faceted approach is recommended. Begin with bioinformatic analysis using tools that predict potential modification sites. For SUMOylation analysis, which has been shown to affect C. elegans protein function as demonstrated with TBX-2, perform RNAi knockdown of UBC-9 (E2 SUMO conjugating enzyme), GEI-17 (E3 SUMO ligase), and SMO-1 (SUMO peptide) . Compare phenotypes and expression patterns before and after RNAi treatment. For direct biochemical verification, express and purify the recombinant protein for mass spectrometry analysis. Additionally, site-directed mutagenesis of predicted modification sites followed by functional assays can determine the biological significance of identified PTMs. Western blot analysis with modification-specific antibodies can also confirm the presence of specific PTMs.

How can I identify potential binding partners or interaction networks of T25E4.2?

To identify protein-protein interactions involving T25E4.2, employ a combination of complementary approaches. Begin with a yeast two-hybrid screen using T25E4.2 as bait against a C. elegans cDNA library. For in vivo validation, perform co-immunoprecipitation (co-IP) experiments using T25E4.2::GFP as the bait, followed by mass spectrometry to identify co-precipitated proteins. BioID or APEX2 proximity labeling methods, where T25E4.2 is fused to a biotin ligase, can identify proteins in close proximity in living cells. For genetic interactions, conduct synthetic lethality screens or RNA-seq analysis comparing wild-type and T25E4.2 mutant strains to identify pathways affected by T25E4.2 loss. Bioinformatic approaches using tools like STRING or GeneMANIA can predict potential interaction partners based on co-expression data, shared domains, or evolutionary conservation patterns.

What is the optimal strategy for generating a T25E4.2 knockout strain?

For generating a T25E4.2 knockout strain, CRISPR-Cas9 genome editing is now the preferred method due to its efficiency and precision. Design multiple guide RNAs targeting exonic regions, preferably early in the gene to ensure complete loss of function. When designing the repair template, include selectable markers or visual reporters to facilitate screening. As an alternative or complementary approach, obtain available deletion alleles from sources like the Caenorhabditis Genetics Center or the National Bioresource Project in Japan . Verify the knockout by PCR genotyping, sequencing, and RT-PCR to confirm the absence of transcript. It's crucial to characterize the knockout phenotype comprehensively, including viability, development timing, fertility, and behavioral assays similar to those used in glutamate receptor studies . Consider creating conditional knockouts if complete loss of T25E4.2 causes lethality.

What expression systems are most appropriate for producing full-length T25E4.2 for biochemical studies?

For biochemical characterization of full-length T25E4.2, several expression systems should be considered based on the protein's properties. For initial attempts, E. coli expression systems (BL21(DE3) or its derivatives) with vectors containing solubility-enhancing tags like MBP, SUMO, or Thioredoxin may be suitable. If solubility issues arise, baculovirus-insect cell systems often yield properly folded full-length eukaryotic proteins with post-translational modifications . For maintaining native PTMs, consider yeast (S. cerevisiae or P. pastoris) or mammalian expression systems (HEK293 or CHO cells). When designing the expression construct, include a purification tag (His, FLAG, or Strep) and a precision or TEV protease cleavage site for tag removal. Optimize expression conditions (temperature, induction time, and inducer concentration) and purification protocols through small-scale pilot experiments before scaling up.

How can I design a reporter system to study the transcriptional regulation of T25E4.2?

To study transcriptional regulation of T25E4.2, construct a series of promoter deletion reporters to identify key regulatory regions. Begin with approximately 5kb of upstream sequence fused to GFP in vectors like pPD95.77 . Create progressive 5' deletions to identify minimal promoter regions required for expression. For more detailed analysis, use site-directed mutagenesis to modify potential transcription factor binding sites identified through bioinformatic analysis. Microinject these constructs into lin-15(n765ts) worms along with a lin-15 rescue plasmid as a co-injection marker to generate transgenic lines . Compare expression patterns across developmental stages and tissues using fluorescence microscopy. To identify trans-acting factors, perform yeast one-hybrid screens or test candidate transcription factors via RNAi knockdown, examining changes in reporter expression. ChIP-seq can also identify regions of the T25E4.2 promoter bound by specific transcription factors in vivo.

How should I interpret phenotypic data from T25E4.2 mutants when results are subtle or variable?

When dealing with subtle or variable phenotypes in T25E4.2 mutants, adopt a rigorous, multi-faceted analytical approach. First, increase your sample size and perform power analysis to ensure statistical robustness. Implement blinded scoring protocols to eliminate observer bias. Control for genetic background effects by comparing multiple independent alleles and performing rescue experiments with wild-type T25E4.2. Environmental factors such as temperature, food quality, and population density can significantly impact C. elegans phenotypes, so standardize these conditions carefully . For behavioral assays, use automated tracking systems for objective quantification. Consider enhancer or suppressor screens to identify genetic interactors that may amplify subtle phenotypes. Finally, examine phenotypes under stress conditions (heat, oxidative stress, starvation) which often reveal functions not apparent under standard laboratory conditions.

What statistical approaches are most appropriate for analyzing T25E4.2 expression data across developmental stages?

For analyzing T25E4.2 expression data across developmental stages, several statistical approaches are appropriate depending on your experimental design. For qRT-PCR data comparing expression at multiple time points, use repeated measures ANOVA with appropriate post-hoc tests, controlling for multiple comparisons. For RNA-seq data, implement time-series analysis packages like maSigPro or next-maSigPro in R to identify significant temporal expression patterns. When analyzing reporter gene expression, quantify fluorescence intensity across developmental stages using image analysis software like ImageJ, followed by non-parametric tests if data don't meet normality assumptions. For spatial expression pattern analysis, consider machine learning approaches for pattern recognition across developmental stages. In all cases, visualize data using heat maps or temporal trajectory plots to identify patterns. Biological replicates are essential, and technical variability should be distinguished from biological variability through appropriate controls and nested experimental designs.

How can I integrate proteomics and transcriptomics data to understand T25E4.2 function?

Integrating proteomics and transcriptomics data requires sophisticated computational approaches. Start by normalizing both datasets using appropriate methods (e.g., TMM for RNA-seq, LFQ for proteomics). Perform correlation analysis between protein and mRNA levels of T25E4.2 across conditions or tissues to identify potential post-transcriptional regulation. Use pathway enrichment analysis tools like GSEA, DAVID, or Metascape to identify biological processes enriched in both datasets. For visualizing integrated data, create protein-protein interaction networks incorporating expression data using tools like Cytoscape with appropriate plugins. Discrepancies between transcript and protein levels can indicate post-transcriptional regulation mechanisms that should be further investigated. For temporal studies, time-delay correlation analysis can reveal sequential activation patterns. Finally, integrate these findings with phenotypic data from T25E4.2 mutants to develop a comprehensive model of the protein's function in cellular processes and developmental pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.