Recombinant Uncharacterized protein T28D9.3 (T28D9.3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Protein T28D9.3 (T28D9.3)

Recombinant Uncharacterized protein T28D9.3, commonly referred to as T28D9.3, is a protein derived from the nematode Caenorhabditis elegans. Despite its designation as "uncharacterized," T28D9.3 has been the subject of research due to its potential roles in various biological pathways. This article aims to provide an overview of T28D9.3, including its expression, purification, and potential applications in life sciences research.

Expression and Purification of T28D9.3

T28D9.3 can be expressed and purified from different host systems, with Escherichia coli and yeast being preferred due to their high yields and shorter turnaround times . Additionally, expression in insect cells using baculovirus or in mammalian cells can provide necessary post-translational modifications for correct protein folding and activity .

Expression Hosts for T28D9.3

Host SystemAdvantages
E. coliHigh yield, short turnaround time
YeastHigh yield, short turnaround time
Insect CellsProvides post-translational modifications
Mammalian CellsProvides post-translational modifications

Available Products for Research

Product NameSource (Host)SpeciesTagProtein Length
Recombinant Full Length Uncharacterized Protein T28D9.3E. coliCaenorhabditis elegansHisFull Length (1-341)

Future Research Directions

Given the lack of comprehensive data on T28D9.3, future research should focus on elucidating its biochemical functions and pathway involvement. This could involve in-depth biochemical assays and cellular studies to understand its role in C. elegans and potential applications in other organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoted the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
plpp-1.2; T28D9.3; Phospholipid phosphatase homolog 1.2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T28D9.3
Target Protein Sequence
MRDHVEFCYYVIIYSLEKFQQRSKQFGISLFIFFLATAAVTVIVPTLLGVSQRGFFCDDD SIRYEYRKDTITAVQLMLYNLVLNAATVLFVEYYRMQKVESNINNPRYRWRNNHLHVLFV RLLTYFGYSQIGFVMNIALNIVTKHVVGRLRPHFLDVCKLANDTCVTGDSHRYITDYTCT GPPELVLEARKSFYSGHSAVSLYCATWSALYIQARLGPVLNNRIVVPISQTLMFMIGLGI SFSRITDNKHHWSDVLVGIFIGIFLAVYTCTFWTDLFSNNSTESETQPLLLPRPPRTPRN SEDEERHRLDAVLPSTDSSIVFEATGPQDSDTILLPVPQSA
Uniprot No.

Target Background

Database Links

STRING: 6239.T28D9.3d

UniGene: Cel.24188

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for recombinant T28D9.3 production?

Recombinant Uncharacterized protein T28D9.3 can be expressed in multiple host systems, each with distinct advantages. E. coli and yeast expression systems provide the highest yields and shorter turnaround times, making them ideal for initial characterization studies and applications requiring substantial protein quantities . For studies requiring post-translational modifications necessary for correct protein folding or activity retention, insect cells with baculovirus or mammalian expression systems are recommended, despite their lower yields .

When selecting an expression system, researchers should consider:

  • Required protein yield for downstream applications

  • Importance of post-translational modifications

  • Timeline constraints for protein production

  • Available laboratory infrastructure and expertise

  • Budget limitations and scale of production needed

How can experimental design optimize the expression and purification of T28D9.3?

Optimization of T28D9.3 expression requires a systematic experimental design approach following these methodological principles:

First, establish a true experimental design with controlled variables to isolate the effect of individual factors on protein expression . This approach ensures causation can be established by controlling for potential confounding variables. Create multiple experimental groups (such as different temperatures, media compositions, or induction conditions) while maintaining control variables constant across all conditions .

For expression optimization, consider:

  • Induction parameters (temperature, inducer concentration, induction timing)

  • Media composition (standard vs. auto-induction, supplemented media)

  • Strain selection (protease-deficient, rare codon supplemented)

  • Fusion tag configurations (N-terminal vs. C-terminal, tag size)

During purification, implement control groups to distinguish between specific and non-specific binding . Random variability, which can obscure the dependent variable (protein yield/purity), should be minimized through technical replicates and standardized protocols .

Document both successful and unsuccessful conditions in a systematic manner to identify patterns and build an optimization strategy that maximizes yield while maintaining protein quality.

How should I determine the optimal fusion tags for T28D9.3 expression and purification?

The selection of fusion tags for T28D9.3 requires a methodical approach comparing multiple options for their effects on solubility, yield, and purification efficiency:

Implement a comparative experimental design with the following methodology:

  • Generate parallel constructs with different fusion tags (His6, GST, MBP, SUMO)

  • Compare both N-terminal and C-terminal positioning of each tag

  • Express under identical conditions to isolate tag effects

  • Evaluate protein distribution between soluble and insoluble fractions

  • Assess purification efficiency via yield and purity metrics

This approach addresses systematic variability between conditions while controlling for random variability that might affect results . Document purification yields quantitatively using standardized protein quantification methods across multiple purification attempts.

When evaluating fusion tags, consider their impact on downstream applications:

  • Structural studies may require tag removal, necessitating efficient protease cleavage sites

  • Functional assays may be affected by bulky tags interfering with protein activity

  • Crystallization is often hindered by flexible tags or incomplete tag removal

The experimental data should be analyzed using appropriate statistical methods to determine significant differences between tag configurations .

What initial characterization approaches are recommended for an uncharacterized protein like T28D9.3?

Initial characterization of T28D9.3 should follow a systematic workflow that gradually builds understanding of the protein's properties:

Begin with computational analysis to develop testable hypotheses:

Follow with basic biochemical characterization:

  • Size exclusion chromatography to determine oligomerization state

  • Circular dichroism to confirm secondary structure elements

  • Thermal shift assays to identify stabilizing conditions

  • Dynamic light scattering to assess homogeneity

For functional investigation, design experiments based on computational predictions:

  • Enzymatic activity screens aligned with predicted domains

  • Binding assays with potential ligands or substrates

  • Protein-protein interaction studies using pull-down assays

This systematic approach allows for iterative refinement of hypotheses and focuses experimental resources efficiently while building a comprehensive characterization profile for T28D9.3.

How can I design experiments to identify potential binding partners of T28D9.3?

Identifying binding partners for an uncharacterized protein like T28D9.3 requires a multi-faceted experimental approach:

Design a protein-protein interaction screening strategy with these methodological components:

  • Affinity purification coupled with mass spectrometry (AP-MS)

    • Express tagged T28D9.3 in relevant cellular context

    • Perform affinity purification under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Compare against control purifications to identify specific interactors

  • Yeast two-hybrid screening

    • Clone T28D9.3 as bait construct

    • Screen against cDNA library from relevant tissue

    • Validate positive interactions with directed tests

    • Confirm interactions using orthogonal methods

  • In vitro binding assays

    • Express and purify recombinant T28D9.3

    • Test interaction with candidate partners using biophysical methods

    • Quantify binding affinity and kinetics

    • Map interaction domains through truncation constructs

When designing these experiments, control for both systematic and random variability to ensure reliable results . Include appropriate positive controls (known interacting protein pairs) and negative controls (non-specific interactions) to establish assay validity .

Follow a decision tree approach where initial high-throughput screens inform more detailed characterization of promising interactions, ultimately leading to functional validation studies.

What analytical methods should be used to assess T28D9.3 structure-function relationships?

Understanding structure-function relationships for T28D9.3 requires integration of structural data with functional assays:

Develop a comprehensive analytical workflow:

When designing structure-function experiments, implement proper experimental controls to distinguish specific effects from experimental artifacts . Document both positive and negative results systematically to build a comprehensive understanding of the relationship between structural elements and functional properties.

How can I investigate post-translational modifications of T28D9.3?

Post-translational modifications (PTMs) often play crucial roles in protein function, particularly for uncharacterized proteins. For T28D9.3, a systematic approach to PTM analysis includes:

Mass spectrometry-based detection methodology:

  • Express T28D9.3 in systems capable of appropriate modifications (insect or mammalian cells)

  • Purify protein under conditions that preserve modifications

  • Perform proteolytic digestion with multiple enzymes for optimal coverage

  • Analyze peptides using high-resolution LC-MS/MS

  • Search data against modification databases

  • Validate potential modifications with targeted MS/MS

For functional characterization of identified PTMs:

  • Generate site-directed mutants at modified residues

  • Compare activity/binding properties between wild-type and mutant proteins

  • Analyze structural impact using biophysical methods

  • Investigate regulation of modifications under different conditions

This comprehensive approach combines discovery proteomics with functional validation to establish the biological significance of PTMs. Document modified residues in relation to predicted domains or structural features to build hypotheses about their functional roles.

What methods are most effective for resolving solubility and stability issues with T28D9.3?

Addressing solubility and stability challenges with T28D9.3 requires a methodical optimization approach:

For improving solubility during expression:

  • Express in E. coli or yeast systems with solubility-enhancing fusion tags

  • Adjust expression temperature and induction conditions

  • Co-express with molecular chaperones

  • Screen multiple buffer compositions for optimal solubilization

For enhancing stability after purification:

  • Perform thermal shift assays to identify stabilizing conditions

  • Test buffer components systematically (pH, salt, additives)

  • Evaluate the effect of ligands or cofactors on stability

  • Optimize storage conditions to prevent aggregation

When designing stability experiments, implement control variables to isolate the effect of individual factors . Document both successful and unsuccessful conditions to establish patterns and optimize multiple parameters simultaneously.

For recalcitrant proteins, consider native chemical ligation or protein engineering approaches to generate stable constructs suitable for functional and structural studies.

How can I design experiments to determine the subcellular localization of T28D9.3?

Determining subcellular localization provides critical insights into protein function. For T28D9.3, implement these methodological approaches:

Fluorescent protein fusion strategy:

  • Create both N- and C-terminal fluorescent protein fusions

  • Express constructs in relevant cell types

  • Visualize using confocal microscopy

  • Co-localize with known organelle markers

  • Validate with multiple fusion configurations to rule out tag interference

Complementary biochemical fractionation:

  • Express recombinant T28D9.3 in appropriate cells

  • Perform subcellular fractionation using differential centrifugation

  • Analyze fractions by Western blotting

  • Compare distribution with known organelle markers

  • Validate findings with immunofluorescence using anti-T28D9.3 antibodies

When designing localization experiments, include appropriate controls to establish specificity :

  • Free fluorescent protein as diffusion control

  • Known proteins with established localization patterns

  • Multiple tag positions to ensure tag doesn't affect localization

What statistical approaches are appropriate for analyzing T28D9.3 experimental data?

Statistical analysis of T28D9.3 experimental data requires careful consideration of experimental design and data characteristics:

For comparative expression/purification experiments:

  • Implement randomized complete block designs to control for batch effects

  • Use ANOVA with appropriate post-hoc tests for multiple condition comparisons

  • Apply paired t-tests for before/after comparisons

  • Consider non-parametric alternatives when normality assumptions are violated

When analyzing expression data, distinguish between systematic variability (differences due to experimental conditions) and random variability (noise that may obscure real effects) . Proper experimental design should maximize the signal-to-noise ratio by controlling for known sources of variation.

For more complex datasets:

  • Consider multivariate analysis for optimizing multiple parameters

  • Implement response surface methodology for optimization experiments

  • Use appropriate regression methods for analyzing relationships between variables

  • Document statistical power calculations to justify sample sizes

When reporting results, include all relevant statistical parameters (test statistics, degrees of freedom, p-values) and clear statements about the uncertainty associated with measurements .

How should I approach conflicting data when characterizing T28D9.3?

Conflicting data is common when studying uncharacterized proteins and requires a systematic resolution approach:

Methodological strategy for resolving conflicts:

  • Evaluate experimental conditions that may explain discrepancies

    • Expression systems used (E. coli vs. yeast vs. mammalian cells)

    • Purification methods and buffer compositions

    • Presence/absence of post-translational modifications

    • Protein concentration and storage conditions

  • Design decisive experiments to address specific conflicts

    • Use orthogonal methods to test the same hypothesis

    • Systematically vary conditions between conflicting protocols

    • Implement blind analysis to reduce confirmation bias

  • Consider biological explanations for apparent conflicts

    • Context-dependent protein behavior

    • Allosteric regulation or conformational changes

    • Interaction-dependent activity differences

When facing conflicting data, maintain detailed records of all experimental conditions and report transparently in publications . This approach acknowledges the complexity of protein behavior while working methodically toward resolution of apparent contradictions.

What information should be included in NIH data tables for T28D9.3 research?

Research on T28D9.3 supported by NIH funding requires proper documentation in standardized data tables:

For NIH training programs involving T28D9.3 research, include the following in data tables:

  • Document participating faculty members (Table 2) involved in T28D9.3 research

  • Detail federal research support related to T28D9.3 work (Table 3)

  • List active research support of faculty working on T28D9.3 (Table 4)

  • Report publications by trainees related to T28D9.3 (Table 5A)

  • Document program outcomes for trainees working on T28D9.3 projects (Table 8A)

For renewal applications, additional documentation is required:

  • Report appointments to the training grant for each project year (Table 7)

  • Document program statistics related to T28D9.3 research (Table 8A, Part III)

When completing these tables, follow the specified formats carefully and combine Tables 1-6 & 8 (for new applications) or Tables 1-8 (for renewals) into a single document for upload to Section 9 of the PHS 398 Research Training Program Plan Forms .

Data presented should accurately reflect research progress, publication outcomes, and training achievements related to T28D9.3 studies.

What PCR and cloning strategies are recommended for T28D9.3 construct generation?

Efficient cloning of T28D9.3 requires optimized PCR and cloning strategies:

PCR optimization methodology:

  • Design primers with appropriate restriction sites for subsequent cloning

  • Determine optimal cycling conditions through gradient PCR

  • Optimize primer concentrations for specific amplification

  • Implement touchdown PCR for difficult templates

For example, when amplifying gene fragments (similar to the SNR-3 approach in the literature):

  • Design specific forward primers with restriction sites (e.g., XbaI)

  • Design reverse primers with different restriction sites (e.g., FseI)

  • Optimize PCR conditions: initial denaturation (95°C, 2 min), followed by 35 cycles of denaturation (95°C, 1 min), annealing (55°C, 1 min), extension (72°C, 1 min), with final extension (72°C, 6 min)

  • Purify amplicons and digest with appropriate restriction enzymes

  • Ligate into expression vectors with compatible sites

For construct validation:

  • Confirm insert sequence by DNA sequencing

  • Verify orientation and reading frame

  • Test expression in small-scale before proceeding to larger preparations

This systematic approach ensures generation of correct constructs while minimizing troubleshooting during expression and purification phases.

What real-time PCR approaches can be used to analyze T28D9.3 expression levels?

Quantitative analysis of T28D9.3 expression requires optimized real-time PCR protocols:

Real-time PCR methodology for T28D9.3:

  • Design gene-specific primers for T28D9.3 (targeting 100-200 bp fragments)

  • Select appropriate internal reference genes for normalization

  • Determine primer efficiency using standard curve experiments

  • Optimize cycling conditions and primer concentrations

Based on similar methodologies in the literature:

  • Prepare reaction mixtures containing 12.5 μL SYBR Green Master Mix, optimized primer concentrations (approximately 100 nM), and 10 ng cDNA template

  • Implement thermal cycling: initial denaturation (95°C, 10 min), followed by 40 cycles of denaturation (95°C, 10 s), annealing (62°C, 10 s), and extension (72°C, 30 s)

  • Run parallel reactions for reference genes

  • Calculate relative expression using efficiency-adjusted ΔΔCт method

For analyzing expression across different conditions:

  • Normalize T28D9.3 expression to reference genes

  • Compare expression levels across different conditions or time points

  • Conduct statistical analysis to identify significant changes

  • Validate findings with independent biological replicates

This approach provides quantitative data on T28D9.3 expression levels that can be correlated with different developmental stages or experimental conditions.

What approaches are effective for functional validation of T28D9.3 regulatory elements?

Functional validation of regulatory elements controlling T28D9.3 expression requires reporter assay systems:

Luciferase reporter methodology:

  • Amplify regulatory regions using PCR with specific primers containing appropriate restriction sites

  • Clone fragments upstream of luciferase in reporter vectors (e.g., pGL4.24)

  • Generate control constructs with fragments in different orientations or positions

  • Transfect constructs into relevant cell types

  • Measure luciferase activity to quantify regulatory element function

For specific regulatory element analysis:

  • Create deletion mutants of putative regulatory elements

  • Perform site-directed mutagenesis to alter specific binding sites

  • Compare reporter activity between wild-type and mutant constructs

  • Correlate regulatory element function with protein expression patterns

This approach systematically identifies functional regulatory elements controlling T28D9.3 expression and can reveal important insights into its transcriptional regulation and biological importance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.