Recombinant Uncharacterized protein T28D9.4 (T28D9.4)

Shipped with Ice Packs
In Stock

Description

Expression Systems

  • E. coli: Utilizes T7 promoter systems (e.g., pET vectors) with tight regulation via lac operators and T7 lysozyme to minimize basal expression .

  • Alternative Systems: Yeast and mammalian cells offer post-translational modifications for specific applications .

Research Applications

While functional annotation remains pending, its applications include:

  • Antigen Production: Used to generate polyclonal antibodies (e.g., Rabbit anti-T28D9.4 IgG for ELISA/Western blot) .

  • Structural Studies: Hydrophobicity profiling and transmembrane predictions aid in computational modeling .

  • Model Organism Studies: Facilitates C. elegans-focused research on developmental biology and neurobiology .

Functional Insights from Homologs

Though uncharacterized, homologs of unannotated proteins in other species have roles in:

  • Metabolic Pathways: Enzymatic activities (e.g., arginine deiminase in NH4+_4^+ production) .

  • Stress Adaptation: pH homeostasis in host environments .

Limitations and Notes

  • Not for Human Use: Strictly for research purposes .

  • Functional Studies Required: Computational annotation and wet-lab experiments (e.g., knockouts) are needed to elucidate biological roles .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
T28D9.4; Uncharacterized protein T28D9.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-468
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T28D9.4
Target Protein Sequence
MVRWKKPKRFLCRKTQDYERIDDIENNDEDSDDDVILEINHDGEHEDNYRNPMIRMAYIP IVIIAVIYSSFIFFFALFIEASAHTNSKCSEAHEKEKMSSGLLTPPMKHILEDRTKYKNE IKLLKTFNVHLTYSTWINSILEILALIYSFLLLLVDRQYLYPLSQVILYLFTRINFVYTD IYGRFFSPSDVVGAITTEVIYDLIRWQSESKLFKVFPFTPCPLPLLLFPIFLSILQVFAN QKHTHVYETVLLIFFRIMTRFAGRRPFILSYQVLRSGIASFQSATSHDIAKTLNKVTHCC LNVFASSAFFVLLMVLVDKQGLDKTPKCLAALYAFAMWMQLATVRYRHFIPLILTVVIEL VITGLVSYQTGEFIFSHTAEVKDYVFTVMFTIIAVFRFVFIIILFKVLIYKNPPHSLTTT VLLKPTNIPVTFSSIKAPQELDPTNPYYPQTVYNSNQSKNNLLPLTRD
Uniprot No.

Target Background

Database Links

STRING: 6239.T28D9.4a

UniGene: Cel.14265

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for T28D9.4 recombinant protein?

The recombinant T28D9.4 protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For optimal stability and activity retention, researchers should:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being recommended) for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C or preferably -80°C

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. The addition of glycerol serves as a cryoprotectant to maintain protein integrity during freezing.

How is protein purity assessed for recombinant T28D9.4?

The purity of recombinant T28D9.4 protein is primarily assessed using SDS-PAGE (Sodium Dodecyl Sulfate-Polyacrylamide Gel Electrophoresis), with commercial preparations typically achieving greater than 90% purity . Researchers may employ additional verification methods including:

  • Western blotting using anti-His antibodies to confirm the presence of the N-terminal His tag

  • Mass spectrometry to verify the molecular weight and sequence coverage

  • Size-exclusion chromatography to assess aggregation states

  • Dynamic light scattering to evaluate size distribution and potential aggregation

For functional studies, it is advisable to perform activity assays specific to the hypothesized function of the protein to ensure that the recombinant form maintains native-like properties.

What experimental approaches can be used to characterize the function of T28D9.4?

Given that T28D9.4 is an uncharacterized protein, several complementary approaches can be employed to elucidate its function:

  • Sequence-Based Analyses:

    • Comparative genomics to identify orthologs in other species

    • Domain prediction to identify functional motifs

    • Secondary structure prediction to understand protein architecture

  • Expression Pattern Analysis:

    • qRT-PCR to determine tissue-specific expression

    • In situ hybridization to visualize spatial expression patterns

    • Reporter gene fusions to monitor expression under different conditions

  • Interaction Studies:

    • Yeast two-hybrid screening to identify potential binding partners

    • Co-immunoprecipitation to confirm in vivo interactions

    • Protein microarrays to identify interactome networks

  • Functional Genomics:

    • RNAi knockdown to observe loss-of-function phenotypes

    • CRISPR-Cas9 gene editing to create null mutants

    • Overexpression studies to identify gain-of-function effects

  • Structural Biology:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • NMR spectroscopy for dynamic structural information

    • Molecular dynamics simulations to predict functional movements

Systematic application of these methods can provide converging evidence about the biological role of T28D9.4.

How might T28D9.4 be involved in cadmium response pathways in C. elegans?

While T28D9.4 is not directly listed among the differentially expressed genes in the cadmium exposure study in search result , the experimental approach described provides a framework for investigating potential roles of T28D9.4 in stress response:

  • Expression Analysis in Stress Conditions:

    • Quantify T28D9.4 expression levels following cadmium exposure at different timepoints

    • Compare expression patterns with known cadmium-responsive genes such as cdr-1, mtl-1, and mtl-2

  • Comparative Response Analysis:
    The table below shows examples of genes upregulated in response to cadmium that could be compared with T28D9.4:

    Gene name4h exposure fold change24h exposure fold change
    cdr-173.4111.4
    mtl-228.731.7
    mtl-117.115.0
    cyp-14A414.932.4
  • Pathway Reconstruction:

    • Determine if T28D9.4 interacts with known cadmium response proteins

    • Map potential signaling cascades that might include T28D9.4

    • Identify regulatory elements in the T28D9.4 promoter that respond to metal stress

  • Phenotypic Analysis:

    • Compare cadmium sensitivity between wild-type and T28D9.4 mutant/RNAi worms

    • Measure physiological parameters like lifespan, reproduction, and development under cadmium stress

    • Analyze subcellular localization changes of T28D9.4 protein during metal exposure

What bioinformatic approaches can predict the membrane topology of T28D9.4?

Based on the amino acid sequence of T28D9.4, several bioinformatic tools can be employed to predict its membrane topology:

  • Transmembrane Domain Prediction:

    • TMHMM, Phobius, or TOPCONS to identify potential membrane-spanning regions

    • MEMSAT to predict transmembrane helix orientation

    • ΔG Prediction Server to calculate the free energy of insertion into membranes

  • Signal Peptide Analysis:

    • SignalP to identify potential signal peptides

    • TargetP to predict subcellular localization

    • PrediSi to assess signal peptide cleavage sites

  • Structural Homology Modeling:

    • AlphaFold or RoseTTAFold to generate 3D structural predictions

    • Comparison with known membrane protein structures in the Protein Data Bank

    • Molecular dynamics simulations to assess stability in membrane environments

  • Hydropathy Analysis:

    • Kyte-Doolittle plots to visualize hydrophobic regions

    • Identification of potential lipid-binding motifs

    • Prediction of amphipathic helices that might interact with membrane interfaces

The predicted topology can then guide experimental approaches such as epitope tagging, protease protection assays, or fluorescence resonance energy transfer (FRET) studies to experimentally validate the computational predictions.

How should researchers design experiments to study T28D9.4 interaction with the membrane?

To investigate T28D9.4's potential membrane interactions, researchers should implement a systematic experimental approach:

  • Subcellular Fractionation:

    • Separate membrane fractions from cytosolic components in C. elegans lysates

    • Perform Western blotting to detect T28D9.4 in different fractions

    • Include positive controls for known membrane proteins

  • Artificial Membrane Systems:

    • Reconstitute purified T28D9.4 into liposomes of defined composition

    • Measure protein integration using flotation assays

    • Assess membrane perturbation using dye leakage assays

  • Chemical Crosslinking:

    • Use membrane-impermeable crosslinkers to identify surface-exposed regions

    • Apply lipid-specific crosslinkers to identify lipid-interacting domains

    • Analyze crosslinked products by mass spectrometry

  • Biophysical Measurements:

    • Circular dichroism spectroscopy to assess secondary structure in membrane mimetics

    • Surface plasmon resonance to quantify membrane binding kinetics

    • Atomic force microscopy to visualize protein-membrane interactions

  • Live Cell Imaging:

    • Generate fluorescent protein fusions for real-time localization studies

    • Employ FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Use super-resolution microscopy to determine precise membrane localization

These approaches should incorporate appropriate controls and consider variables like membrane composition, pH, and ionic strength that may affect protein-membrane interactions.

What are the key considerations for optimizing recombinant expression of T28D9.4?

Optimizing recombinant expression of T28D9.4, especially for structural and functional studies, requires careful consideration of several parameters:

  • Expression System Selection:

    • E. coli: Currently used for T28D9.4 expression , suitable for high yield but may lack post-translational modifications

    • Yeast: Provides eukaryotic processing capabilities while maintaining reasonable yields

    • Insect cells: Better for complex eukaryotic proteins with multiple domains

    • Mammalian cells: Optimal for authentic post-translational modifications

  • Vector Design:

    • Codon optimization for the chosen expression system

    • Selection of appropriate promoters (T7, CMV, etc.)

    • Inclusion of fusion tags beyond His (GST, MBP) to enhance solubility

    • Incorporation of protease cleavage sites for tag removal

  • Expression Conditions:

    • Temperature optimization (often lower temperatures improve folding)

    • Induction parameters (inducer concentration, timing)

    • Media composition and supplementation

    • Co-expression with chaperones for improved folding

  • Purification Strategy:

    • Sequential chromatography steps (IMAC, ion exchange, size exclusion)

    • Buffer optimization to maintain protein stability

    • Detergent selection for membrane protein solubilization

    • Quality control at each purification step

  • Functional Verification:

    • Activity assays based on predicted function

    • Structural integrity assessment (CD spectroscopy, thermal shift assays)

    • Binding assays with predicted interaction partners

    • Stability testing under various storage conditions

A systematic optimization approach using design of experiments (DoE) methodologies can efficiently identify optimal conditions while minimizing experimental runs.

How can researchers interpret contradictory results in T28D9.4 functional studies?

When confronted with contradictory results in functional studies of T28D9.4, researchers should implement a structured analytical approach:

  • Methodological Evaluation:

    • Compare experimental conditions between contradictory studies

    • Assess protein quality and verification methods

    • Evaluate the sensitivity and specificity of assays used

    • Consider differences in model systems or genetic backgrounds

  • Contextual Analysis:

    • Examine environmental conditions that might affect protein function

    • Consider developmental stages or tissue-specific effects

    • Analyze potential redundancy with related proteins

    • Investigate regulatory mechanisms that might explain conditional activity

  • Integration of Multiple Data Types:

    • Combine results from different experimental approaches

    • Weight evidence based on methodological rigor

    • Use computational models to reconcile apparently contradictory data

    • Perform meta-analysis when sufficient studies are available

  • Alternative Hypothesis Generation:

    • Formulate new models that accommodate seemingly contradictory results

    • Design critical experiments to distinguish between competing hypotheses

    • Consider multifunctional roles that might explain different observations

    • Explore condition-dependent protein functions

  • Collaborative Resolution:

    • Engage with researchers reporting contradictory results

    • Establish standardized protocols for community-wide use

    • Perform side-by-side experiments in different laboratories

    • Develop shared resources like validated antibodies or cell lines

By systematically addressing contradictions, researchers can advance understanding of T28D9.4's true biological functions rather than dismissing challenging data.

What statistical approaches are most appropriate for analyzing T28D9.4 expression data?

When analyzing expression data for T28D9.4, researchers should select statistical methods based on experimental design and data characteristics:

  • Differential Expression Analysis:

    • For microarray data: limma (linear models for microarray data)

    • For RNA-seq: DESeq2 or edgeR

    • For qPCR: ΔΔCt method with appropriate reference genes

    • Include multiple test correction (Benjamini-Hochberg or Bonferroni)

  • Time Series Analysis:

    • ANOVA with repeated measures for time course experiments

    • Mixed effect models to account for subject-specific variation

    • Functional data analysis for continuous time profiles

    • Time-frequency analysis for oscillatory expression patterns

  • Correlation Analysis:

    • Pearson correlation for normally distributed data

    • Spearman correlation for non-parametric relationships

    • Partial correlation to control for confounding variables

    • Canonical correlation for multivariate relationships

  • Network Analysis:

    • Weighted gene co-expression network analysis (WGCNA)

    • Bayesian network inference to identify causal relationships

    • Graph theoretical approaches to identify hub genes

    • Enrichment analysis for functional interpretation

  • Visualization Techniques:

    • Heatmaps for expression patterns across conditions

    • Volcano plots for significance and fold change representation

    • Principal component analysis for dimensionality reduction

    • Gene set enrichment plots for pathway-level analysis

The statistical approach should match the experimental design, with appropriate power analysis conducted during planning stages to ensure sufficient sample sizes for detecting biologically meaningful differences in T28D9.4 expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.