Recombinant Uncharacterized protein ybfB (ybfB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uncharacterized Protein ybfB (ybfB)

Recombinant E. coli ybfB (UniProt: P0AAU6) is a member of the TrpD2 protein family, initially annotated as uncharacterized but recently studied for its DNA-binding properties and role in bacterial stress responses. This protein is expressed as a homodimer with electropositive grooves that interact with nucleic acids, though only one groove binds DNA due to negative cooperativity within the dimer . The recombinant form is produced via heterologous expression systems (e.g., E. coli, yeast, or baculovirus) for research purposes, including vaccine development .

Quaternary Structure

  • Homodimer Formation: ybfB exists as a homodimer with two electropositive DNA-binding grooves .

  • Negative Cooperativity: In vitro studies show only one groove binds DNA due to steric hindrance or allosteric effects .

  • Monomer Behavior: A monomerized variant retains DNA-binding affinity but lacks cooperative effects .

PropertyValue/DescriptionSource
Molecular Weight~12 kDa (per subunit)
DNA Binding AffinityK<sub>D</sub> = 10–100 nM
Sequence SpecificityNon-specific (binds ss/ds DNA equally)

SOS Response Involvement

  • LexA Regulation: The ybfB gene is co-transcribed with dinG (a DNA helicase) and is part of the LexA-controlled SOS response, activated by DNA damage .

  • Speculative Function: Proposed roles include stabilizing DNA during repair or modulating transcriptional responses to stress .

Interaction Partners

  • dinG Helicase: Co-expressed with dinG, suggesting a functional link to DNA repair processes .

  • Other Orphans: While not explicitly studied, ybfB’s operon structure hints at potential interactions with other uncharacterized proteins in stress pathways .

Expression Systems

Recombinant ybfB is typically produced in E. coli using inducible promoters:

PromoterVector OriginCarbon SourceStrainNotes
T7pMB1’GlycerolBL21(DE3)High expression under IPTG induction
trcpMB1’GlycerolBL21 ΔackAReduced acetate production improves yield
tacpMB1’GlycerolBL21Tight regulation via lactose or IPTG

Purification and Stability

  • Tags: Commonly produced without tags or with affinity tags (e.g., His-tag) .

  • Buffer: Tris-based buffer with 50% glycerol for storage at -20°C .

DNA-Binding Mechanism

  • Cooperative Binding: Multiple ybfB molecules bind longer DNA fragments cooperatively, though only one groove per dimer engages in vitro .

  • Sequence Promiscuity: Binds both single-stranded (ssDNA) and double-stranded (dsDNA) with minimal affinity difference .

Functional Studies

AssayObservationSource
Electrophoretic Mobility ShiftRetarded DNA migration due to binding
Thermal StabilityStable under physiological conditions
Negative CooperativityReduced binding efficiency in dimer vs. monomer

Vaccine Development

  • Non-Homology to Human Proteins: Recombinant ybfB lacks sequence similarity to human proteins, making it a candidate for subunit vaccines .

  • Antigenic Potential: While not explicitly tested, its cytoplasmic localization and stability suggest feasibility for immunogenic studies .

Stress Response Research

  • Model for SOS Pathways: ybfB’s role in the LexA regulon provides a tool to study DNA damage responses in E. coli .

  • Drug Target Identification: Further studies could explore its interaction with antibiotics targeting DNA repair processes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ybfB; Z0849; Uncharacterized protein YbfB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
ybfB
Target Protein Sequence
MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFI ALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK
Uniprot No.

Target Background

Database Links

KEGG: ece:Z0849

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant uncharacterized protein ybfB?

Recombinant uncharacterized protein ybfB can be expressed in various host systems, with each offering distinct advantages. E. coli and yeast expression systems typically provide the highest yields and shortest turnaround times for initial characterization studies . These prokaryotic hosts are particularly valuable for preliminary structural studies due to their cost-effectiveness and rapid growth characteristics.

For proteins requiring post-translational modifications for proper folding or activity, insect cells with baculovirus or mammalian cell expression systems may be more appropriate despite their increased complexity and cost . The choice of expression system should be guided by the specific research questions being addressed:

Expression HostAdvantagesLimitationsBest For
E. coliHigh yields, rapid growth, economical, simple media requirementsLimited post-translational modifications, inclusion body formation commonInitial characterization, structural studies, high-throughput screening
YeastModerate-high yields, eukaryotic processing capabilities, economicalSome glycosylation patterns differ from mammalian cellsProteins requiring some post-translational modifications
Insect cellsGood yields, complex eukaryotic processingMore expensive, longer production timeProteins requiring extensive post-translational modifications
Mammalian cellsMost authentic post-translational modificationsMost expensive, lowest yields, longest production timeProteins requiring authentic mammalian processing

What are the primary challenges in expressing uncharacterized proteins like ybfB?

Expressing uncharacterized proteins presents several distinct challenges that must be addressed methodically:

Protein solubility is often the most significant initial hurdle, as uncharacterized proteins frequently form inclusion bodies when overexpressed . Without prior knowledge of the protein's properties, optimizing solubility requires systematic testing of multiple expression conditions.

Codon usage bias between the source organism and expression host can significantly impact translation efficiency . Using codon-optimized synthetic genes or selecting appropriate host strains can address this challenge.

Protein toxicity to the host organism may occur when the protein disrupts essential cellular processes . In such cases, using tightly controlled inducible promoters or expression systems with lower basal expression can mitigate toxicity effects.

Unknown cofactor requirements or binding partners may also affect proper folding and stability of the recombinant protein . Supplementing growth media with potential cofactors or co-expressing binding partners may improve yields of functional protein.

What initial characterization steps should be performed for uncharacterized protein ybfB?

Initial characterization of uncharacterized protein ybfB should follow a systematic approach:

  • Bioinformatic analysis: Conduct sequence analysis to identify conserved domains, potential structural motifs, and homologs in other organisms . Tools like BLAST, Pfam, and structural prediction algorithms can provide initial insights into potential functions.

  • Expression optimization: Test multiple expression conditions using small-scale cultures to identify parameters yielding soluble protein . Variables include host strain, media composition, induction temperature, inducer concentration, and expression duration.

  • Purification strategy development: Design a purification scheme based on predicted protein properties and validate with analytical techniques such as SDS-PAGE and Western blotting .

  • Basic biochemical characterization: Determine fundamental properties including molecular weight, oligomerization state, stability under various buffer conditions, and potential enzymatic activities .

  • Preliminary functional assays: Design hypothesis-driven assays based on predicted functions from bioinformatic analysis to begin elucidating the protein's role .

How can statistical experimental design improve recombinant ybfB expression?

Statistical experimental design methodologies offer significant advantages over traditional one-factor-at-a-time approaches when optimizing expression conditions for uncharacterized proteins like ybfB. Multivariate methods allow systematic evaluation of multiple parameters simultaneously, revealing interactions between variables that might otherwise remain undetected .

Factorial design is particularly valuable for recombinant protein expression, as it enables the efficient identification of significant variables affecting protein production with fewer experiments . For recombinant ybfB expression, a fractional factorial design can be implemented to evaluate key parameters:

  • Identify critical variables: Based on literature for similar proteins, variables typically include induction absorbance, inducer concentration, expression temperature, media components (yeast extract, tryptone, glucose, glycerol), and antibiotic concentration .

  • Design a fractional factorial experiment: For eight variables, a 2^(8-4) design provides a statistically robust approach while reducing the experimental workload .

  • Define measurable responses: Key responses include cell growth (biomass), protein activity (if a functional assay is available), and process productivity (yield per time) .

  • Statistical analysis: Analyze results using ANOVA to identify statistically significant variables and interactions .

The implementation of such designs has demonstrated substantial improvements in soluble protein yields, with some studies reporting increases from negligible expression to 250 mg/L of functional recombinant protein .

What specific variables should be optimized for maximal soluble expression of ybfB?

Based on experimental design studies with recombinant proteins, the following variables have been identified as statistically significant for soluble protein expression and should be systematically optimized for ybfB:

VariableEffect on ExpressionOptimization Approach
Induction absorbanceHigher cell density at induction typically increases total protein yieldTest range from OD600 0.4-1.0, with 0.8 often optimal
Expression temperatureLower temperatures (15-25°C) generally improve protein folding and solubilityCompare standard (37°C) vs. reduced temperatures (15-30°C)
Inducer concentrationLower IPTG concentrations often improve solubility while maintaining good expressionTest range from 0.01-1.0 mM IPTG, with 0.1 mM often sufficient
Media compositionComplex media components affect growth rate and protein expressionEvaluate yeast extract (1-10 g/L), tryptone (1-10 g/L) concentrations
Carbon sourceGlucose represses basal expression; glycerol provides slower, more consistent growthTest presence/absence of glucose (0-10 g/L) and glycerol (0-10 g/L)

Statistical analysis from published studies indicates that induction absorbance, expression temperature, and tryptone concentration often have the most significant effects on cell growth, while temperature, tryptone concentration, and kanamycin concentration significantly affect functional protein yield .

How can I develop a systematic purification strategy for uncharacterized protein ybfB?

Developing a purification strategy for an uncharacterized protein requires a methodical approach based on predicted protein properties:

  • Affinity tag selection: For initial characterization, fusion tags like 6xHis, GST, or MBP facilitate purification while potentially enhancing solubility . For ybfB, a 6xHis tag allows for metal affinity chromatography as a capture step.

  • Lysis buffer optimization: Screen multiple buffer conditions varying pH (6.0-8.0), salt concentration (100-500 mM NaCl), and additives (glycerol, reducing agents) to maximize protein stability and solubility during extraction .

  • Chromatography sequence design: Implement a multi-step purification process:

    • Capture: Immobilized metal affinity chromatography (IMAC) for His-tagged ybfB

    • Intermediate: Ion exchange chromatography based on predicted isoelectric point

    • Polishing: Size exclusion chromatography to achieve final purity and assess oligomerization state

  • Quality assessment: Evaluate protein purity by SDS-PAGE, confirm identity by mass spectrometry, and assess structural integrity through circular dichroism or thermal shift assays .

  • Stability optimization: Screen buffer conditions for long-term storage using differential scanning fluorimetry to identify stabilizing additives .

What approaches can be used to determine the function of uncharacterized protein ybfB?

Determining the function of uncharacterized proteins like ybfB requires an integrated approach combining computational predictions with experimental validation:

  • Domain analysis and structural prediction: Identify conserved domains and structural motifs that may suggest function . For example, the presence of SANT or BTB domains (as seen in the SANBR protein) might suggest DNA-binding or protein-protein interaction capabilities .

  • Protein-protein interaction studies: Implement pull-down assays, yeast two-hybrid screens, or proximity labeling approaches to identify binding partners that may provide functional context .

  • Subcellular localization: Determine the cellular compartment where ybfB functions through fluorescent tagging or subcellular fractionation .

  • Genetic approaches: Generate knockout/knockdown models to observe phenotypic effects, or perform complementation studies if orthologs exist in model organisms .

  • Biochemical activity assays: Based on computational predictions, design assays to test potential enzymatic activities or regulatory functions .

The successful functional characterization of the previously uncharacterized protein SANBR demonstrates the effectiveness of this integrated approach . In that case, researchers identified it as a negative regulator of class switch recombination in B cells through a systematic screen followed by domain-specific functional validation .

How can I resolve contradictions in experimental data when characterizing novel proteins?

When characterizing novel proteins like ybfB, researchers often encounter contradictory data that must be systematically analyzed and resolved:

  • Identify the source of contradiction: Determine whether contradictions arise from technical variability, biological complexity, or incompletely controlled variables .

  • Implement anti-pattern analysis: This approach, borrowed from knowledge graph analysis, can help identify minimal sets of contradictory data patterns . Applied to protein characterization, this involves:

    • Mapping experimental conditions to outcomes

    • Identifying minimal sets of conditions that yield contradictory results

    • Generalizing these patterns to identify underlying causes

  • Statistical validation: Use appropriate statistical methods to determine if apparent contradictions are statistically significant or within expected experimental variation .

  • Controlled variable isolation: Systematically isolate and test individual variables that may contribute to contradictory results . For example, if different expression conditions yield proteins with different activities, each variable should be tested independently.

  • Orthogonal method validation: Confirm key findings using multiple independent techniques to rule out method-specific artifacts .

A systematic approach to resolving contradictions can transform apparent inconsistencies into valuable insights about protein behavior under different conditions .

What techniques are most effective for studying protein-protein interactions of uncharacterized proteins?

For uncharacterized proteins like ybfB, understanding protein-protein interactions can provide critical functional insights. Multiple complementary approaches should be employed:

  • Affinity purification-mass spectrometry (AP-MS): This approach involves purifying the tagged protein of interest along with its binding partners, followed by mass spectrometric identification . For example, the BTB domain of SANBR was shown to interact with corepressor proteins including HDAC and SMRT using this approach .

  • Yeast two-hybrid screening: This genetic approach can identify binary interactions and is particularly valuable for detecting transient interactions that may be lost during biochemical purification .

  • Proximity labeling: Techniques such as BioID or APEX2 allow in vivo labeling of proteins in close proximity to the protein of interest, providing spatial context for potential interactions .

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): These biophysical techniques provide quantitative measurements of binding affinities and kinetics for validated interactions .

  • Crosslinking mass spectrometry: This approach can capture transient interactions and provide structural information about interaction interfaces .

The combination of these techniques provides a comprehensive view of the protein's interactome, offering insights into potential functional roles and regulatory mechanisms.

How can recombinant ybfB be used to generate antibodies for further research?

Generating antibodies against uncharacterized proteins presents unique challenges that require careful planning:

  • Antigen preparation: Purified recombinant ybfB can serve as the immunogen, ideally in its native conformation to generate antibodies recognizing the native protein . If full-length protein expression proves challenging, consider using:

    • Soluble domains identified through bioinformatic analysis

    • Synthetic peptides corresponding to predicted surface-exposed regions

    • Fusion proteins that maintain native epitopes

  • Immunization strategy: For polyclonal antibodies, implement a standard immunization protocol using purified recombinant ybfB with appropriate adjuvants . For monoclonal antibodies, consider:

    • Traditional hybridoma technology

    • Phage display approaches using synthetic antibody libraries

    • Single B-cell isolation and antibody cloning

  • Antibody validation: This critical step must include multiple controls:

    • Specificity testing against recombinant protein and native samples

    • Cross-reactivity assessment with related proteins

    • Application-specific validation (Western blot, immunoprecipitation, immunofluorescence)

    • Validation in knockout/knockdown systems to confirm specificity

  • Epitope mapping: For uncharacterized proteins, identifying the specific epitopes recognized by antibodies provides valuable structural information and ensures antibodies target distinct protein regions .

What computational tools are most valuable for predicting functions of uncharacterized proteins like ybfB?

Computational approaches form an essential component of uncharacterized protein analysis, providing testable hypotheses for experimental validation:

  • Sequence-based analysis:

    • BLAST and PSI-BLAST for identifying distant homologs

    • Multiple sequence alignment to identify conserved residues

    • Hidden Markov Models (HMMs) for domain prediction

    • Evolutionary analysis to identify functionally important residues

  • Structure-based prediction:

    • AlphaFold or RoseTTAFold for accurate structural modeling

    • Structure comparison with DALI or TM-align to identify structural homologs

    • Active site prediction through structural analysis

    • Molecular docking to predict potential binding partners or substrates

  • Genome context analysis:

    • Gene neighborhood analysis to identify functional associations

    • Gene fusion events that may suggest functional relationships

    • Co-expression analysis across multiple conditions

    • Phylogenetic profiling to identify co-evolving genes

  • Integrated approaches:

    • Machine learning methods combining multiple features

    • Network-based approaches incorporating protein-protein interaction data

    • Pathway enrichment analysis of predicted interacting partners

These computational approaches provide a framework for generating testable hypotheses about ybfB function that can guide experimental design and interpretation.

How can I address poor solubility of recombinant ybfB?

Poor solubility is one of the most common challenges when expressing uncharacterized proteins. A systematic approach to improving solubility includes:

  • Expression parameter optimization:

    • Reduce induction temperature to 15-25°C to slow protein synthesis and improve folding

    • Decrease inducer concentration to reduce expression rate

    • Use rich media supplements to provide additional folding resources

    • Induce at higher cell densities when cells are more metabolically robust

  • Fusion tag strategies:

    • Test solubility-enhancing tags such as MBP, GST, SUMO, or Trx

    • Position tags at either N- or C-terminus to determine optimal configuration

    • Include flexible linkers between the tag and target protein

  • Co-expression approaches:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J, ClpB)

    • Include rare tRNA genes for heterologous expression

    • Co-express with potential binding partners if identified

  • Buffer optimization:

    • Screen various pH conditions (typically pH 6.0-8.0)

    • Test different salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol, arginine, trehalose)

Statistical analysis of experimental design studies indicates that expression temperature and media composition often have the strongest effects on protein solubility . The factorial design approach enables efficient identification of optimal conditions for specific proteins.

What strategies can improve functional activity of recombinant ybfB?

Obtaining functionally active recombinant protein presents distinct challenges from simply achieving soluble expression:

  • Post-translational modification considerations:

    • Select expression systems capable of required modifications

    • Engineer modification sites if necessary

    • Implement in vitro modification strategies when appropriate

  • Cofactor incorporation:

    • Supplement growth media with potential cofactors

    • Add cofactors during purification and storage

    • Implement reconstitution protocols after purification

  • Refolding approaches:

    • If inclusion bodies form, develop a refolding protocol

    • Screen various refolding methods (dilution, dialysis, on-column)

    • Optimize refolding buffer components systematically

  • Activity preservation during purification:

    • Minimize exposure to potentially denaturing conditions

    • Include stabilizing agents in all buffers

    • Reduce purification steps to minimize activity loss

  • Storage optimization:

    • Determine optimal buffer conditions for long-term stability

    • Test various cryoprotectants and storage temperatures

    • Evaluate activity retention after freeze/thaw cycles

Functional activity should be monitored throughout the optimization process using appropriate biochemical or biophysical assays, as exemplified by the hemolytic activity assay used for rPly characterization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.