Recombinant Uncharacterized protein yfhR (yhfR)

Shipped with Ice Packs
In Stock

Description

General Information

CategoryDescription
Gene NameyhfR
SynonymsyhfR; STY2793; t0309; Uncharacterized protein YfhR
UniProt IDQ8Z4M8
SpeciesSalmonella typhi
SourceE. coli
TagHis
Protein LengthFull Length (1-292)
AA SequenceMTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPTPAEAESITFTAKDGT HLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSWLPERNVNLFMFDYRGFGESE GTPSQEGLLNDTKSAIDYVRHRADVNPERLVLLGQSLGGNNVLAAVGHCVGCANMRYADQ AGIRAIVLDSTFSSYSSIANQMIPGSGYLLDDRYSADRNIASVSPIPVLILHGTADHVIP WQDSEKLYALAREPKQKIFIPDGDHIDAFSGRYANLYRDAMINFIQTALSAK
Molecular WeightInformation Not Available
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .

Production

Recombinant YfhR is typically produced in E. coli and tagged with a histidine tag (His-tag) for purification purposes . The His-tag allows the protein to be easily purified using immobilized metal affinity chromatography (IMAC) . After purification, the protein can be lyophilized (freeze-dried) for long-term storage .

Function and Research

As an uncharacterized protein, the precise function of YfhR is not yet known . Proteins like YfhR are identified through genome sequencing and bioinformatics analysis, but their roles in the cell require further experimental investigation. Research on uncharacterized proteins like YfhR may involve:

  • Determining the protein's structure: This can provide clues about its function .

  • Identifying its interacting partners: This can help to elucidate the protein's role in cellular pathways .

  • Analyzing its expression pattern: This can provide information about when and where the protein is active .

  • Knockout studies: Disrupting the gene that encodes YfhR and observing the effects on the organism can reveal its function .

Conformational Analysis of Therapeutic Proteins

The correct conformation of therapeutic proteins, such as recombinant YfhR, is essential to ensure their safety and efficacy . Hydroxyl radical protein footprinting is a method used for comparison of therapeutic protein conformations . This method involves oxidizing the protein with hydroxyl radicals and then using liquid chromatography-mass spectrometry (LC-MS) to analyze the oxidation patterns . The rate of oxidation of amino acids reveals the protein's conformation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
yhfR; Z3802; ECs3400; Uncharacterized protein YfhR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
yhfR
Target Protein Sequence
MALPVNKRVPKILFILFVVAFCVYLVPRVAINFFYYPDDKIYGPDPWSAESVEFTAKDGT RLQGWFIPSSTGPADNAIATIIHAHGNAGNMSAHWPLVSWLPERNFNVFMFDYRGFGKSK GTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANILAVIGQGDREGIRAVILD STFASYATIANQMIPGSGYLLDESYSGENYIASVSPIPLLLIHGKADHVIPWQHSEKLYS LAKEPKRLILIPDGEHIDAFSDRHGDVYREQMVNFILSALNPQN
Uniprot No.

Target Background

Database Links

KEGG: ece:Z3802

STRING: 155864.Z3802

Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the yfhR protein and where is it found?

The yfhR protein is an uncharacterized protein identified in several bacterial species, primarily in Bacillus subtilis and Salmonella typhimurium. In B. subtilis, the yfhR gene is located upstream of the sspE locus in the genome and has been identified as an oxidoreductase homologue based on sequence similarity to known proteins . The yfhR gene is also known as fabL or ygaA in some bacterial species, where it encodes enoyl-[acyl-carrier-protein] reductase [NADPH] FabL, a component of fatty acid biosynthesis .

Transcriptional analysis has shown that yfhR is expressed during the exponential growth phase in B. subtilis, indicating its potential importance in actively growing cells . The protein appears to be conserved across various bacterial species, suggesting an evolutionarily significant function.

What are the known or predicted functions of yfhR?

Based on sequence homology and genomic context, yfhR has several predicted functions:

  • Oxidoreductase activity: The protein is predicted to function as an oxidoreductase, likely utilizing NADPH as a cofactor .

  • Fatty acid biosynthesis: When referred to as fabL, the protein encodes enoyl-[acyl-carrier-protein] reductase [NADPH] FabL, an enzyme involved in bacterial fatty acid biosynthesis .

  • Antibiotic resistance: Most significantly, yfhR/fabL has been linked to resistance against the antibiotic and antimycotic compound irgasan/triclosan, which is known to target bacterial fatty acid synthesis .

While these functions have been predicted based on sequence analysis and genomic context, full experimental validation is still ongoing for many bacterial species where yfhR remains classified as an uncharacterized or hypothetical protein.

How is yfhR gene transcription regulated?

The transcriptional regulation of yfhR shows interesting patterns that provide clues about its biological role:

In Bacillus subtilis, transcriptional analysis has revealed that:

  • yfhR is primarily transcribed during the exponential growth phase .

  • It can be transcribed individually or co-transcribed with other genes, including yfhQ and/or the sspE gene during exponential growth .

  • The transcription of the yfhQ-yfhR-sspE loci increased 5.3-fold in a yfhP-deficient strain compared to the wild-type strain at t-2 (2 hours before initiation of sporulation) .

  • Transcription corresponding to the yfhR-sspE loci increased more than twofold with maximum values observed at t-15 .

These findings suggest that YfhP acts as a negative regulator for the transcription of yfhR, yfhQ, sspE, and yfhP itself . The complex regulation pattern indicates that yfhR may play important roles during different growth phases, particularly during active cell growth and the transition to sporulation in B. subtilis.

What experimental design approaches are most effective for characterizing uncharacterized proteins like yfhR?

Characterizing uncharacterized proteins like yfhR requires a multi-faceted experimental design approach that combines complementary methods:

Table 1: Experimental Design Framework for Uncharacterized Protein Characterization

Experimental ApproachTechniquesApplication to yfhRExpected Outcomes
Sequence AnalysisBLAST, Multiple Sequence Alignment, Motif DetectionIdentify homology to known oxidoreductasesPrediction of catalytic residues and substrate specificity
Expression SystemsE. coli, yeast, insect cells, mammalian cellsExpression of recombinant yfhR with proper foldingPurified protein for structural and functional studies
Structural AnalysisX-ray crystallography, Cryo-EM, NMRDetermination of yfhR three-dimensional structureInsight into catalytic mechanism and substrate binding
Biochemical AssaysEnzyme kinetics, substrate screening, cofactor analysisTesting predicted oxidoreductase activityConfirmation of enzymatic function and substrate specificity
Genetic ApproachesGene knockout, complementation studiesAssessment of phenotypic effects of yfhR deletionUnderstanding of biological function and essentiality
Transcriptomic AnalysisRNA-Seq, qPCRIdentification of conditions affecting yfhR expressionContext for protein function and regulation
Proteomic ApproachesMass spectrometry, protein-protein interaction studiesIdentification of yfhR interaction partnersPlacement of yfhR in biological pathways

For effective experimental design, researchers should follow these principles:

  • Systematic variable control: Identify and control independent and dependent variables while minimizing confounding factors .

  • Randomization: Implement proper randomization to reduce bias, especially in comparative studies .

  • Replication: Include both biological and technical replicates to ensure statistical validity .

  • Validation across systems: Test findings in multiple bacterial species to determine conservation of function .

For yfhR specifically, given its predicted oxidoreductase function and potential role in antibiotic resistance, the experimental design should include assays testing enzymatic activity with potential substrates and experiments examining resistance to irgasan/triclosan .

How can researchers design experiments to validate the predicted role of yfhR in antibiotic resistance?

To investigate the potential role of yfhR/fabL in antibiotic resistance, particularly against irgasan/triclosan, researchers can implement a comprehensive experimental design:

  • Genetic Manipulation Studies:

    • Generate yfhR knockout mutants using CRISPR-Cas9 or traditional homologous recombination

    • Create yfhR overexpression strains with inducible promoters

    • Develop complementation systems to verify phenotype rescue

    • Generate site-directed mutants targeting predicted catalytic residues

  • Antibiotic Susceptibility Testing:

    • Determine minimum inhibitory concentrations (MICs) of irgasan/triclosan for:

      • Wild-type strains

      • yfhR knockout mutants

      • yfhR overexpression strains

      • Complemented mutants

    • Conduct time-kill kinetics to assess bactericidal effects

    • Perform growth curve analyses under various antibiotic concentrations

  • Molecular Mechanism Studies:

    • Express and purify recombinant yfhR protein from E. coli or yeast systems

    • Conduct binding assays between purified yfhR and irgasan/triclosan

    • Perform enzymatic assays to determine if irgasan/triclosan acts as:

      • A substrate

      • A competitive inhibitor

      • An allosteric inhibitor

    • Study structural interactions through crystallography or molecular docking

  • Transcriptomic and Proteomic Responses:

    • Analyze gene expression changes in response to sub-inhibitory antibiotic concentrations

    • Compare proteome profiles between sensitive and resistant strains

    • Identify potential compensatory mechanisms in resistant strains

  • Evolution of Resistance:

    • Perform laboratory evolution experiments under antibiotic selection

    • Sequence evolved strains to identify mutations in yfhR or related genes

    • Test cross-resistance to other antibiotics targeting fatty acid biosynthesis

When designing these experiments, researchers should implement randomized controlled trial principles from experimental design methodology, ensuring proper controls, adequate sample sizes, and appropriate statistical analyses . This systematic approach will help establish a causal relationship between yfhR function and antibiotic resistance.

How should researchers approach contradictory data regarding yfhR function?

When confronted with contradictory data about yfhR function, researchers should employ a structured approach to resolve discrepancies:

  • Identify the Source of Contradiction:

    • Examine differences in experimental conditions (bacterial strains, growth media, temperature)

    • Compare methodological approaches that yielded different results

    • Assess statistical validity of contradicting studies (sample size, p-values, confidence intervals)

    • Consider biological context differences (growth phase, stress conditions)

  • Analytical Framework for Resolving Contradictions:

    • Apply systematic validation approaches across multiple conditions

    • Use orthogonal experimental methods to verify results

    • Consider that contradictions may reveal context-dependent functions

  • Common Causes of Contradictory Data for Uncharacterized Proteins:

Table 2: Sources of Contradictions and Resolution Strategies

Source of ContradictionExample for yfhRResolution Strategy
Different expression systemsProtein active in E. coli but not in yeastTest multiple expression systems with appropriate controls
Post-translational modificationsActivity depends on specific modificationsUse expression systems that maintain required modifications
Environmental conditionsFunction varies with pH, temperature, saltSystematically test function across condition gradients
Substrate availabilityNarrow vs. broad substrate specificityScreen comprehensive substrate panels
Protein interaction partnersFunction depends on specific protein complexesPerform interaction studies in native and heterologous contexts
Technical artifactsContaminating activities from expression hostInclude appropriate negative controls and purification validation
  • Handling Contradictory Results in RAG Contexts:
    Recent research highlights the importance of detecting contradictions in retrieved information . When analyzing literature about yfhR:

    • Identify self-contradictory documents where a single source contains internally inconsistent information

    • Recognize contradicting document pairs presenting conflicting information

    • Consider conditional contradictions where context determines whether information is contradictory

  • Data Integration Approach:

    • Weight evidence based on methodological rigor

    • Consider multiple hypotheses that might explain all observations

    • Develop new experiments specifically designed to address contradictions

    • Use meta-analytical approaches to synthesize conflicting data

When applied to yfhR specifically, this approach can help resolve whether apparent differences in function (oxidoreductase activity vs. antibiotic resistance mediator) represent distinct functions of the same protein or context-dependent manifestations of a single underlying mechanism .

What are the optimal expression and purification strategies for recombinant yfhR protein?

Obtaining pure, correctly folded recombinant yfhR protein is essential for reliable functional and structural studies. The following methodological framework outlines evidence-based best practices:

  • Expression System Selection:
    Based on available data, several expression systems have been successfully used for yfhR protein production :

    • E. coli systems: Offer the best yields and shorter turnaround times, making them ideal for initial characterization studies or when large quantities of protein are needed.

    • Yeast expression systems: Also provide good yields with relatively short production times, and may offer some post-translational modifications not available in bacterial systems.

    • Insect cells with baculovirus: These systems can provide many of the post-translational modifications necessary for correct protein folding, which may be crucial for functional studies.

    • Mammalian cells: These expression systems may help retain the protein's activity through appropriate post-translational modifications, particularly important for structural or functional studies that require the protein to be in its native conformation.

  • Expression Optimization Parameters:

Table 3: Optimization Parameters for yfhR Expression

ParameterRecommendations for yfhRRationale
Temperature16-25°C for E. coli systemsLower temperatures reduce inclusion body formation for oxidoreductases
Induction time16-24 hours for low temperatureExtended induction maximizes yield while minimizing misfolding
MediaTerrific Broth (TB) supplemented with glucoseRich media increases yield; glucose prevents leaky expression
Fusion tagsN-terminal His6 or MBPHis6 for simple purification; MBP for enhanced solubility
Codon optimizationConsider rare codon usageOxidoreductases often contain rare codons in bacterial systems
AdditivesNADPH (0.1-0.5 mM)Stabilizes protein structure if NADPH-dependent
  • Purification Strategy:
    For optimal purification of yfhR, a multi-step approach is recommended:

    • Initial capture: Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Intermediate purification: Ion exchange chromatography based on predicted pI

    • Polishing: Size exclusion chromatography for final purity and buffer exchange

    This approach has been successfully applied to similar uncharacterized proteins .

  • Quality Control Considerations:

    • Verify purity by SDS-PAGE (aim for >95% purity)

    • Confirm identity by mass spectrometry peptide mass fingerprinting

    • Assess structural integrity by circular dichroism

    • Validate activity using predicted oxidoreductase function assays

  • Storage Recommendations:

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

    • Include glycerol (10-20%) as a cryoprotectant

    • Consider adding reducing agents if the protein contains cysteines

    • If NADPH-dependent, include NADPH in storage buffer

These methodological guidelines have been derived from successful approaches used for similar proteins and should provide a solid foundation for producing high-quality recombinant yfhR suitable for downstream applications .

How can researchers develop robust assays to measure yfhR enzymatic activity?

Developing robust assays for yfhR enzymatic activity requires careful consideration of its predicted oxidoreductase function and potential role in antibiotic resistance. The following methodological framework provides a systematic approach:

  • Assay Development Strategy:

    • Begin with broad-spectrum oxidoreductase assays

    • Narrow down to specific substrate classes based on results

    • Validate with multiple orthogonal methods

    • Establish controls to confirm specificity

  • Primary Screening Assays:

Table 4: Oxidoreductase Activity Screening Assays for yfhR

Assay TypePrincipleDetection MethodAdvantagesLimitations
NADPH/NADH consumptionMonitor cofactor oxidationAbsorbance at 340 nmSimple, quantitative, real-timeNon-specific, interference from other components
Tetrazolium salt reductionElectron transfer to artificial acceptorColorimetric (formazan formation)High sensitivity, endpoint measurementPotential for artifacts, non-physiological
Hydrogen peroxide productionCoupled peroxidase assayFluorescence or colorimetricCan detect oxidase activityIndirect, potential for false positives
Oxygen consumptionDirect measurement of O2Clark electrode or optical sensorsDirect measurement of oxidase activityRequires specialized equipment
Substrate-specific assaysDirect measurement of product formationHPLC, LC-MS, or GC-MSDefinitive proof of activityRequires prediction of products
  • Assay Optimization Parameters:

    • pH optimization (typically pH 6.0-9.0 for oxidoreductases)

    • Temperature range (25-37°C)

    • Buffer composition (phosphate, HEPES, or Tris)

    • Cofactor concentration (0.1-1.0 mM NADPH or NADH)

    • Substrate concentration range (for Km determination)

    • Enzyme concentration validation (linear response range)

  • Controls and Validation:

    • Heat-inactivated enzyme (negative control)

    • Known oxidoreductase with similar predicted function (positive control)

    • Substrate and cofactor-only controls

    • Inhibitor studies (if known inhibitors exist)

    • Site-directed mutants of predicted catalytic residues

  • Specialized Assays for Antibiotic Resistance Function:
    If yfhR/fabL is involved in triclosan resistance as predicted :

    • Direct binding assays between purified yfhR and triclosan using:

      • Isothermal Titration Calorimetry (ITC)

      • Surface Plasmon Resonance (SPR)

      • Fluorescence-based binding assays

    • Enzymatic activity in the presence of triclosan at various concentrations

    • Competition assays with natural substrates and triclosan

  • Data Analysis Considerations:

    • Determine enzyme kinetic parameters (Km, Vmax, kcat)

    • Calculate inhibition constants (Ki) if applicable

    • Analyze substrate specificity patterns

    • Compare activity under different conditions to identify optimal function

By implementing this comprehensive assay development strategy, researchers can definitively characterize the enzymatic function of yfhR and its potential role in antibiotic resistance mechanisms .

What bioinformatic approaches should researchers use to predict yfhR function before experimental validation?

Bioinformatic approaches provide valuable initial insights into yfhR function that can guide experimental design. A comprehensive computational analysis should include:

  • Sequence-Based Analysis Pipeline:

    • Homology searches: BLAST and PSI-BLAST reveal yfhR is similar to oxidoreductase family proteins

    • Multiple sequence alignment: Identify conserved residues across bacterial species

    • Domain prediction: InterPro and Pfam searches identify NAD(P)H-binding domains

    • Motif analysis: Look for characteristic oxidoreductase motifs (e.g., Rossmann fold)

    • Phylogenetic analysis: Determine evolutionary relationships with characterized proteins

  • Structural Prediction Methods:

    • 3D structure prediction: AlphaFold2 or RoseTTAFold can predict structure with high confidence

    • Structure comparison: Compare predicted structure with known oxidoreductases

    • Active site identification: Predict catalytic residues based on structural alignment

    • Molecular docking: Predict interactions with potential substrates and triclosan

  • Genomic Context Analysis:

    • Gene neighborhood examination: The location near sspE provides functional context

    • Operon prediction: Determine if co-transcription with yfhQ implies functional relationships

    • Co-expression analysis: Identify genes with similar expression patterns

  • Integrated Function Prediction:

Table 5: Integrated Bioinformatic Analysis Results for yfhR

Prediction MethodToolPrediction for yfhRConfidence LevelEvidence
Sequence homologyBLASTPOxidoreductase/FabLHighSignificant similarity to characterized oxidoreductases
Function predictionInterProScanNAD(P)H-dependent oxidoreductaseHighPresence of conserved oxidoreductase domains
Structural predictionAlphaFold2Rossmann fold characteristic of oxidoreductasesMedium-HighPredicted with high confidence score
Genomic contextOperon analysisAssociated with fatty acid biosynthesisMediumCo-regulation with related genes
Pathway mappingKEGGFatty acid biosynthesis pathwayMediumBased on fabL annotation
Integrated predictionCombined evidenceEnoyl-[acyl-carrier-protein] reductase conferring triclosan resistanceHighConsistent across multiple prediction methods
  • Translating Predictions to Testable Hypotheses:
    Based on bioinformatic predictions, researchers should prioritize testing:

    • NADPH-dependent oxidoreductase activity

    • Interaction with fatty acid biosynthesis substrates

    • Direct binding to triclosan

    • Role in triclosan resistance mechanisms

  • Limitations and Considerations:

    • Computational predictions should be treated as hypotheses requiring experimental validation

    • Novel functions may not be detected by homology-based methods

    • Proteins can have multiple or moonlighting functions

    • Structural predictions may miss dynamic or disorder regions important for function

For yfhR specifically, the computational evidence strongly supports an oxidoreductase function related to fatty acid biosynthesis, with a potential role in triclosan resistance . These predictions provide a solid foundation for targeted experimental validation studies.

How can researchers effectively manage and analyze data from yfhR characterization studies?

  • Data Management Framework:

    • Implement structured data organization from the outset

    • Maintain detailed metadata for all experiments

    • Use electronic lab notebooks with standardized templates

    • Establish version control for analysis scripts and protocols

    • Create a centralized repository for all raw and processed data

  • Quality Control and Preprocessing:

    • Develop standard operating procedures (SOPs) for data collection

    • Implement automated quality checks for experimental data

    • Normalize data appropriately for cross-experiment comparisons

    • Apply statistical methods to identify and handle outliers

    • Maintain complete records of all data transformations

  • Integrative Analysis Approaches:

Table 6: Integrative Data Analysis Strategy for yfhR Characterization

Data TypeAnalysis ApproachSoftware/ToolsExpected Outcomes
Sequence analysisMultiple sequence alignment, phylogenyClustal Omega, MEGA, IQ-TREEEvolutionary relationships, conserved residues
Structural dataStructure validation, comparisonPyMOL, UCSF Chimera, PDBeFoldStructural features, function prediction
Expression dataDifferential expression analysisDESeq2, EdgeRRegulatory patterns, condition-dependent expression
Enzymatic activityKinetic parameter calculationGraphPad Prism, RKm, Vmax, substrate specificity, inhibition patterns
Antibiotic resistanceDose-response modelingR (drc package), GraphPad PrismMIC values, resistance mechanisms
Multi-omics integrationNetwork analysis, pathway enrichmentCytoscape, STRING, KEGGFunctional context, interaction networks
  • Statistical Considerations:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple hypothesis correction for high-throughput data

    • Conduct power analysis to ensure adequate sample sizes

    • Consider biological and technical variability in experimental design

    • Implement robust statistical methods resilient to outliers

  • Handling Contradictory Data:
    As noted in recent research on RAG systems , contradictions in data require special handling:

    • Identify self-contradictory results within experiments

    • Categorize contradictions between experiments

    • Develop targeted experiments to resolve contradictions

    • Consider contextual factors that might explain discrepancies

    • Weight evidence based on methodological strength

  • Data Visualization and Communication:

    • Create clear, informative visualizations that accurately represent data

    • Present uncertainty and variability transparently

    • Develop multidimensional visualizations for complex relationships

    • Maintain consistency in visualization styles across related analyses

    • Structure findings to address the key research questions

  • Integration with Existing Knowledge:

    • Compare results with published literature on related proteins

    • Consider evolutionary context when interpreting function

    • Relate findings to broader biological pathways and systems

    • Identify knowledge gaps for future research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.