Recombinant Uncharacterized protein ygaM (ygaM)

Shipped with Ice Packs
In Stock

Description

Protein Overview and Classification

YgaM is a small membrane protein identified in Escherichia coli with a length of 113 amino acids . It belongs to the YqjD/ElaB/YgaM paralogs family, a group of proteins that has been identified as membrane-bound ribosome-binding proteins . These proteins are classified within the DUF883 (Domain of Unknown Function 883) family, which is widely distributed across proteobacteria and some other bacterial phyla .

Evolutionary Relationships

Sequence analysis reveals significant conservation patterns among the YqjD/ElaB/YgaM paralogs. YgaM shares 42% sequence identity with YqjD and 34% sequence identity with ElaB . This high degree of sequence similarity suggests shared evolutionary origins and potentially overlapping functions among these proteins. Bioinformatic analyses indicate that these proteins are conserved across various bacterial species, highlighting their evolutionary importance .

Protein Domains and Secondary Structure

YgaM contains recognizable DUF883 domains (IPR043604: DUF883, N-terminal domain and IPR043605: DUF883, C-terminal domain) . Structurally, it is characterized as a predominantly α-helical protein with a distinctive helix-breaking proline residue positioned immediately after the transmembrane domain .

The protein exhibits a specialized architecture with:

  • A transmembrane helix region

  • A conserved helix-breaking proline residue

  • An arginine-lysine motif at the C-terminus, which differs from the double arginine motifs found in YqjD and ElaB

Membrane Anchoring

YgaM is classified as a C-tail anchored membrane protein in E. coli . Among the three paralogs (YqjD, ElaB, and YgaM), it possesses the shortest predicted transmembrane helix but the longest C-terminal periplasmic tail . This structural arrangement suggests a specific orientation and positioning within the bacterial membrane that may be crucial for its function in ribosome binding.

The transmembrane region contains several conserved glycine residues and a conserved tryptophan residue that follows the helix-breaking proline . These features likely play important roles in stabilizing the protein's membrane orientation.

Functional Properties

Recent research has significantly expanded our understanding of ygaM's cellular functions, revealing its important role in ribosomal activity and bacterial stress response.

Ribosome Binding and Hibernation

YgaM functions as a membrane-anchored ribosome-binding protein that participates in ribosome hibernation processes . Ribosome hibernation is a conserved strategy across all domains of life that protects ribosomes under unfavorable conditions and regulates developmental processes . YgaM, along with its paralogs YqjD and ElaB, constitutes a class of ribosome-hibernating proteins with widespread distribution across bacterial species .

Protein Synthesis Inhibition

Experimental evidence indicates that YgaM can inhibit in vitro protein synthesis by interacting with the 50S ribosomal subunit . In vivo cross-linking combined with mass spectrometry has revealed specific interactions between these proteins and the regions surrounding the ribosomal tunnel exit . Intriguingly, these proteins appear to penetrate into the ribosomal tunnel itself, suggesting a mechanism of translation inhibition that involves blocking the ribosomal tunnel .

This mechanism resembles the action of certain antimicrobial peptides and macrolide antibiotics, which also inactivate ribosomes by blocking the ribosomal tunnel . This finding suggests potential applications in antimicrobial research or as tools for studying ribosomal function.

Regulation of Expression

YgaM production is controlled by the stationary phase-specific σ-factor RpoS . This regulatory control suggests that ygaM plays a role in bacterial adaptation to stationary phase conditions, where resources become limited and cellular metabolism needs to be adjusted accordingly.

Protein Interactions

YgaM participates in several protein-protein interactions that contribute to its cellular functions and regulatory activities.

Interactions with Paralogs

STRING database analysis reveals strong functional associations between ygaM and its paralogs:

  • YqjD (interaction score: 0.948)

  • ElaB (interaction score: 0.947)

These high interaction scores indicate significant functional relationships, consistent with their shared roles in ribosome binding and hibernation.

Other Protein Interactions

YgaM also shows notable interactions with several other proteins:

  • Dps (Fe-binding and storage protein, score: 0.882)

  • OsmE (Osmotically-inducible lipoprotein, score: 0.872)

  • YeaG (Protein kinase, score: 0.860)

  • YiaG (Putative transcriptional regulator, score: 0.854)

  • YbaY (Outer membrane lipoprotein, score: 0.850)

These interactions suggest potential roles in stress response, particularly related to stationary phase adaptation and survival under adverse conditions.

Recombinant Production and Handling

The production of recombinant ygaM protein has been established to facilitate research into its structure and function.

Expression Systems

Recombinant full-length ygaM protein can be successfully expressed in E. coli expression systems . When produced as a recombinant protein, it is often fused with an N-terminal His tag to facilitate purification through affinity chromatography methods .

Research Applications

While ygaM remains classified as an "uncharacterized protein," its recently discovered functions in ribosome binding and protein synthesis inhibition suggest several potential research applications.

Study of Bacterial Ribosome Regulation

As a ribosome-hibernation factor, recombinant ygaM serves as a valuable tool for investigating the mechanisms of ribosomal regulation during stress conditions and stationary phase . Its ability to inhibit protein synthesis provides opportunities to study translation control mechanisms in bacteria.

Antimicrobial Research

The mechanism by which ygaM inactivates ribosomes by blocking the ribosomal tunnel resembles the action of certain antibiotics . This similarity suggests potential applications in antimicrobial research, possibly as a model for developing new translation-targeting antibiotics or understanding resistance mechanisms.

Bacterial Membrane Biology

As a C-tail anchored membrane protein with distinctive structural features, ygaM offers insights into membrane protein topology and insertion mechanisms . Studies using recombinant ygaM can enhance our understanding of membrane protein biogenesis and organization.

Future Research Directions

Despite recent advances, several aspects of ygaM protein remain to be fully characterized, presenting opportunities for future research.

Physiological Significance

Further investigation into the physiological conditions that trigger ygaM-mediated ribosome hibernation would enhance our understanding of bacterial stress responses and adaptation mechanisms.

Therapeutic Potential

Given its mechanism of ribosome inactivation, research into potential biotechnological or therapeutic applications of ygaM or derived peptides could be explored, particularly in the context of antimicrobial development.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ygaM; c3223; Uncharacterized protein YgaM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
ygaM
Target Protein Sequence
MGDHMFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKE TRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMRKS
Uniprot No.

Target Background

Database Links

KEGG: ecc:c3223

STRING: 199310.c3223

Protein Families
ElaB/YgaM/YqjD family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ygaM protein and where is it found?

ygaM is a putative membrane-anchored DUF883 family ribosome-binding protein found in Escherichia coli K12. It consists of 109 amino acids and belongs to the ElaB/YgaM/YqjD family of proteins . This class of proteins is conserved across all proteobacteria and some other bacterial phyla, suggesting an important conserved function .

What is the known function of ygaM?

Recent research has demonstrated that ygaM functions as a ribosome-hibernating protein. It inhibits in vitro protein synthesis by interacting with the 50S ribosomal subunit . Ribosome hibernation is a common strategy in bacteria that protects ribosomes under unfavorable conditions and regulates developmental processes. YgaM and its paralogs (YqjD and ElaB) appear to constitute a previously unrecognized class of ribosome-hibernating factors .

What are the major protein interaction partners of ygaM?

Based on STRING database analysis, ygaM has several predicted functional partners with high confidence scores:

Protein PartnerDescriptionInteraction Score
yqjDMembrane-anchored ribosome-binding protein0.948
elaBPutative membrane-anchored DUF883 family ribosome-binding protein0.947
dpsFe-binding and storage protein0.882
osmEOsmotically-inducible lipoprotein0.872
yeaGProtein kinase, endogenous substrate unidentified0.860
yiaGHTH_CROC1 family putative transcriptional regulator0.854
ybaYOuter membrane lipoprotein0.850

These interaction scores suggest strong functional relationships, particularly with other membrane-anchored ribosomal binding proteins .

What expression systems are most suitable for recombinant ygaM production?

For membrane-associated proteins like ygaM, the choice of expression system significantly impacts yield and functionality. While E. coli remains the most common host for bacterial protein expression, specific considerations for ygaM include:

For basic research quantities:

  • E. coli BL21(DE3) with pET-based vectors using a C-terminal His-tag can provide adequate yields

  • For membrane proteins, E. coli C41(DE3) or C43(DE3) strains may offer better expression

For structural studies requiring higher yields:

  • Bacterial systems with enhanced membrane protein expression capabilities

  • Consideration of alternative hosts such as Vibrio natriegens, which has shown better soluble expression for some proteins compared to E. coli

The methodological approach should include optimization of induction parameters, as membrane protein overexpression often leads to toxicity and inclusion body formation .

How can researchers address the challenge of ygaM solubility during expression?

Recombinant ygaM, like many membrane-associated proteins, presents solubility challenges. Methodological approaches include:

  • Fusion tag selection:

    • MBP (maltose-binding protein) fusion can increase solubility

    • SUMO fusion has shown success with membrane proteins

  • Solubilization methods:

    • The freeze-thaw solubilization method has shown success for recovering functionally active proteins from inclusion bodies

    • For membrane proteins, mild detergents like n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at optimized concentrations can maintain native structure

  • Expression conditions optimization:

    • Lower induction temperatures (16-25°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Use of specialized media formulations

How can researchers study ygaM's role in ribosome hibernation experimentally?

Investigating ygaM's role in ribosome hibernation requires sophisticated approaches:

  • In vitro translation assays:

    • Cell-free protein synthesis systems using purified ribosomes to measure inhibition

    • Dose-dependent assays comparing wild-type vs. mutant ygaM

  • Ribosome interaction studies:

    • Cryo-electron microscopy to visualize ygaM-ribosome complexes

    • Chemical cross-linking combined with mass spectrometry (as mentioned in the literature) to map interaction sites

    • Fluorescence-based binding assays to determine binding kinetics

  • Functional genomics approaches:

    • CRISPR-Cas9 knockout strains of ygaM and its paralogs (yqjD, elaB) to assess phenotypes

    • Complementation studies with mutant variants to identify critical residues

    • Transcriptomic analysis under stress conditions to assess regulation

What methodologies can resolve the structural features of ygaM's interaction with the ribosomal tunnel?

Research has shown that ygaM paralogs interact with proteins surrounding the ribosomal tunnel exit and penetrate into the ribosomal tunnel . Investigating this requires:

  • High-resolution structural analysis:

    • Cryo-EM of ygaM-ribosome complexes at different functional states

    • X-ray crystallography of ygaM in complex with tunnel components

    • NMR for dynamic interaction studies

  • Proximity-based labeling approaches:

    • APEX2-based proximity labeling to identify proteins near ygaM in vivo

    • BioID protein interaction mapping during ribosome hibernation

  • Functional probing of the ribosome tunnel:

    • Site-directed mutagenesis of key residues

    • Accessibility measurements using chemical probes

    • Fluorescence resonance energy transfer (FRET) to measure dynamic changes

How is ygaM expression regulated in response to stress conditions?

While specific ygaM regulation data is limited, research on ribosome hibernation factors suggests:

  • Stress response regulation:

    • Assessment of ygaM expression under various stress conditions (nutrient limitation, stationary phase, temperature stress)

    • Promoter analysis for stress-responsive elements

    • Analysis of transcriptional regulators (potential role of yiaG, a predicted transcriptional regulator that interacts with ygaM)

  • Methodological approaches:

    • qRT-PCR to measure ygaM expression under different conditions

    • Reporter gene fusions (ygaM promoter-GFP) to monitor regulation

    • ChIP-seq to identify transcription factors binding to the ygaM promoter

What quantitative methods best detect ygaM protein levels in different bacterial growth phases?

For accurate quantification of ygaM:

  • Western blotting optimization:

    • Generation of specific antibodies against ygaM

    • Use of epitope tags (FLAG, HA) for commercial antibody detection

    • Quantitative western blotting using internal standards

  • Mass spectrometry-based quantification:

    • Selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

    • SILAC or TMT labeling for relative quantification across conditions

    • Absolute quantification using heavy isotope-labeled peptide standards

  • Growth phase correlation:

    Growth PhaseRecommended Detection MethodSample Preparation
    Lag phaseTargeted mass spectrometryGentle lysis to maintain membrane association
    ExponentialWestern blot or flow cytometryStandard protocols
    StationaryMultiple methods with higher sensitivityIncreased sample input
    Stress-inducedImmunoprecipitation followed by MSCross-linking preservation

How can researchers differentiate the functions of ygaM from its paralogs yqjD and elaB?

Distinguishing the specific roles within this paralog family requires:

  • Comparative biochemical characterization:

    • Side-by-side ribosome binding assays

    • In vitro translation inhibition comparisons

    • Detergent solubilization profiles and membrane association experiments

  • Genetic approaches:

    • Single, double, and triple knockout strains

    • Complementation assays with each paralog

    • Synthetic genetic array analysis to map genetic interactions

  • Expression pattern analysis:

    • Comparison of expression under different stress conditions

    • Co-expression analysis with interacting partners

    • Promoter swapping experiments to test functional equivalence

What computational methods can predict functional differences between ygaM and other DUF883 family proteins?

Advanced computational biology approaches include:

  • Sequence-based analyses:

    • Multiple sequence alignment of DUF883 family members

    • Conservation analysis to identify subfamily-specific residues

    • Coevolution analysis to detect functional networks

  • Structural bioinformatics:

    • Homology modeling based on related structures

    • Molecular dynamics simulations of membrane interactions

    • Protein-protein docking with ribosomal components

  • Systems biology integration:

    • Network analysis of protein-protein interactions

    • Integration of transcriptomic data with protein interaction networks

    • Machine learning approaches to predict functional differences

What are the optimal buffer conditions for maintaining ygaM stability during purification?

For membrane-associated proteins like ygaM:

  • Buffer optimization:

    • pH range testing (typically 7.0-8.0)

    • Salt concentration screening (150-500 mM NaCl)

    • Addition of stabilizing agents (glycerol 5-15%)

    • Detergent screening panel (DDM, LDAO, OG, CHAPS)

  • Stability assessment methods:

    • Differential scanning fluorimetry (DSF)

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Limited proteolysis to identify stable domains

  • Recommended starting buffer composition:

    ComponentConcentrationPurpose
    Tris-HCl pH 8.020-50 mMpH buffering
    NaCl300 mMIonic strength
    Glycerol10%Stability
    DDM0.03%Solubilization
    TCEP1 mMReducing agent

How can researchers design experiments to study ygaM's role in bacterial stress response?

Experimental design should include:

  • Stress condition panel:

    • Oxidative stress (H₂O₂, paraquat)

    • Osmotic stress (high salt, sucrose)

    • Nutrient limitation (carbon, nitrogen starvation)

    • Antibiotics targeting protein synthesis

  • Phenotypic assays:

    • Growth curves under stress conditions

    • Viability assays after stress exposure

    • Metabolic activity measurements

    • Ribosome profiling to assess translation changes

  • Molecular response assessment:

    • Transcriptomics (RNA-seq) of wild-type vs. ygaM knockout

    • Proteomics to identify differentially expressed proteins

    • Metabolomics to detect stress-related metabolites

    • Ribosome association analysis during stress response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.