Recombinant Uncharacterized protein yggT (yggT)

Shipped with Ice Packs
In Stock

Description

Definition and Background

Recombinant Uncharacterized protein yggT (yggT) is a genetically engineered form of the Escherichia coli YggT protein, a conserved but poorly characterized integral membrane protein encoded by the yggT gene. This protein belongs to an operon (yggSTU-rdgB-hemW) with unclear functional correlations between its members . While native YggT is implicated in potassium ion (K⁺) homeostasis under hyperosmotic stress , recombinant yggT is primarily produced for structural, functional, and biomedical research .

Native Biological Functions

  • K⁺ Uptake Regulation: Compensates for K⁺ deficiency in E. coli mutants lacking primary K⁺ transporters under hyperosmotic stress .

  • Antibiotic Susceptibility Modulator: ΔyggT mutants exhibit 184% increased adhesion to human cells and heightened sensitivity to gentamicin, suggesting a role in biofilm formation and antibiotic resistance .

  • Genetic Interactions: Co-expressed with yggS, yggU, rdgB, and hemW, though functional linkages remain undefined .

Key Phenotypes of ΔyggT Mutants

ParameterΔyggT PhenotypeComplementation Outcome
Adhesion to Human Cells184% increaseReduced to 13% of wild-type levels
Gentamicin ToleranceComplete bacterial eliminationNot restored
MotilityUnaffected (vs. ΔflgH, which loses motility)N/A

Applications in Research

Recombinant yggT is utilized in:

  • Antibiotic Resistance Studies: Investigating mechanisms of biofilm-mediated antibiotic tolerance .

  • Membrane Protein Characterization: Structural analysis of conserved bacterial membrane proteins .

  • Vaccine Development: Explored as a potential antigen for E. coli-targeted vaccines (preclinical stage) .

Challenges and Future Directions

  • Functional Elucidation: The precise biochemical role of yggT remains unknown, necessitating enzymology or structural studies (e.g., cryo-EM) .

  • Therapeutic Potential: Further validation is required to assess its utility in combating antibiotic-resistant E. coli infections .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yggT; c3538; Uncharacterized protein YggT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
yggT
Target Protein Sequence
MNTLTFLLSTVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQPIIGPLRRVIPAMGP IDSASLLVAYILSFIKAIVLFKVVTFLPIIWIAGLLILLKTIGLLIFWVLLVMAIMSWVS QGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMILVLLLYVINMGVAEVLQATGNML LPGLWMAL
Uniprot No.

Target Background

Database Links

KEGG: ecc:c3538

STRING: 199310.c3538

Protein Families
YggT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is yggT and what is known about its structure?

yggT is an integral membrane protein belonging to the YggT family, found in Escherichia coli strain K12. The protein consists of 188 amino acids with a molecular mass of approximately 21.2 kDa . The protein sequence is known and available in protein databases, though its three-dimensional structure has not been fully characterized. The protein is encoded by the yggT gene, which is part of a polycistronic operon (yggSTU-rdgB-hemW) in E. coli .

What is the genomic context of the yggT gene?

The yggT gene is located in a polycistronic operon that consists of five poorly characterized genes: yggS-yggT-yggU-yggV-yggW . Within this operon, yggS is involved in isoleucine and valine metabolism regulation, yggU encodes an uncharacterized protein, yggV (also known as rdgB) codes for a nucleoside triphosphate pyrophosphatase that hydrolyzes dITP and XTP, and yggW (hemW) encodes a heme chaperone . Upstream of the yggS gene lies yggR, which encodes a putative transporter annotated as a type II/IV secretion system family protein with only 17 bp separating yggR and yggS start codons .

What functional roles have been attributed to yggT?

Current research suggests that yggT likely plays a role in potassium uptake mechanisms in bacteria. Under hyperosmotic conditions, overexpression of yggT compensates for growth defects in E. coli mutant cells that lack major potassium uptake systems . Additionally, homologs of YggT in other organisms have been implicated in the biogenesis of the c' heme in the cytochrome b6f complex in Chlamydomonas reinhardtii and in the proper distribution of nucleoids in chloroplasts and cyanobacteria . These diverse functions suggest yggT may have multiple roles depending on the cellular context.

What are the challenges in expressing membrane proteins like yggT?

Expressing membrane proteins such as yggT presents several challenges including proper folding, toxicity to host cells, and difficulties in solubilization and purification. Since yggT is an integral membrane protein, specialized approaches are often required. These may include:

  • Using weak promoters to prevent overwhelming the host cell's membrane insertion machinery

  • Employing fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Optimizing growth conditions (temperature, induction timing, media composition)

  • Using specialized E. coli strains designed for membrane protein expression

  • Considering cell-free expression systems for highly toxic membrane proteins

Successful expression often requires testing multiple constructs and conditions to optimize yield and proper folding.

What purification strategies work best for recombinant yggT?

Purification of membrane proteins like yggT typically follows a multi-step approach:

  • Membrane isolation: Separate cell membranes containing the overexpressed protein

  • Solubilization: Extract the protein using appropriate detergents (common choices include DDM, LDAO, or OG)

  • Initial purification: Immobilized metal affinity chromatography (IMAC) utilizing His-tags

  • Secondary purification: Size exclusion chromatography to improve purity

  • Quality assessment: SDS-PAGE, Western blotting, and functional assays

When designing purification protocols, it's essential to maintain the native conformation of yggT, particularly if functional studies are intended. The choice of detergent is critical, as it must effectively solubilize the protein while preserving its structure and activity.

How can researchers assess the putative potassium transport function of yggT?

To investigate yggT's role in potassium transport, several complementary approaches can be employed:

  • Complementation studies: Introduce plasmid-borne yggT into E. coli strains lacking major potassium uptake systems (like strain TK2420 that lacks Kdp, Trk, and Kup systems) and assess growth restoration under high osmotic pressure conditions .

  • Potassium uptake assays: Measure radioactive 86Rb+ or 42K+ uptake in cells expressing or lacking yggT to directly quantify transport activity.

  • Growth phenotype analysis: Compare growth curves of wild-type and yggT-deficient strains under various potassium concentrations and osmotic conditions.

  • Electrophysiology: Reconstitute purified yggT into liposomes or planar lipid bilayers to measure ion conductance and selectivity using patch-clamp techniques.

  • Fluorescence-based assays: Utilize potassium-sensitive fluorescent dyes to monitor real-time changes in potassium flux in cells with modulated yggT expression.

These methods should be performed under various environmental conditions (pH, temperature, osmolarity) to fully characterize the functional properties of yggT.

What approaches can be used to study protein-protein interactions involving yggT?

Understanding the interaction partners of yggT is crucial for elucidating its cellular functions. Several methods are suitable for this purpose:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of yggT and isolate protein complexes for identification of interaction partners .

  • Bacterial two-hybrid systems: Specialized for membrane proteins, these systems can detect interactions in a cellular context.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify proteins in close proximity to yggT.

  • Split-fluorescent protein complementation: Visualize interactions in live cells by tagging potential partners with complementary fluorescent protein fragments.

  • Proximity-dependent biotin identification (BioID): Fuse yggT with a biotin ligase to biotinylate nearby proteins for subsequent isolation and identification.

When interpreting interaction data, researchers should be aware that membrane protein interactions are highly dependent on the lipid environment, and detergent-solubilized proteins may exhibit altered interaction profiles.

How does yggT function relate to the activities of other proteins in the yggSTU-rdgB-hemW operon?

The genomic organization of yggT within a polycistronic operon suggests possible functional relationships between these proteins, though no direct correlation has been experimentally established between yggS and the downstream genes including yggT . Recent research on yggS has shown that it regulates isoleucine and valine metabolism by modulating 2-ketobutyrate and coenzyme A availability . The hemW gene product functions as a heme chaperone involved in transferring heme into respiratory chain enzymes .

To investigate potential functional relationships, researchers should consider:

  • Constructing and characterizing operon deletion mutants vs. single gene deletions

  • Performing transcriptional analyses to determine if genes are co-regulated

  • Conducting proteomic studies to identify changes in protein abundance when yggT is deleted

  • Testing for physical interactions between proteins encoded in this operon

  • Examining phenotypic similarities between mutants of different operon genes

Understanding these relationships could reveal whether yggT functions independently or as part of a larger metabolic or stress-response system.

What are the structure-function relationships in yggT and how do they compare with homologs across species?

Although detailed structural information about yggT is limited, comparative analysis with homologs can provide insights into its function:

  • Sequence analysis: Multiple sequence alignments of yggT homologs can identify conserved residues likely critical for function.

  • Topology prediction: Computational modeling to predict membrane-spanning regions and potential functional domains.

  • Mutational analysis: Systematic mutagenesis of conserved residues to identify those essential for function.

  • Homology modeling: If structural data exists for related proteins, construct models of yggT's likely structure.

  • Evolutionary analysis: Phylogenetic studies to track the co-evolution of yggT with other cellular components.

Homologs of YggT in photosynthetic organisms have been implicated in functions related to the cytochrome b6f complex and nucleoid distribution in chloroplasts and cyanobacteria , suggesting possible evolutionary adaptation of this protein family to diverse functions.

How does yggT expression respond to environmental stressors and metabolic changes?

Understanding the regulation of yggT expression can provide insights into its physiological roles:

  • Transcriptional profiling: RNA-seq or qPCR analysis under various stress conditions (osmotic stress, nutrient limitation, pH changes, etc.)

  • Promoter analysis: Characterize the promoter region and identify potential transcription factor binding sites.

  • Reporter gene assays: Fuse the yggT promoter to reporter genes to monitor expression changes in response to environmental cues.

  • Chromatin immunoprecipitation (ChIP): Identify transcription factors that bind to the yggT promoter region.

Current evidence suggests that transcription of rdgB (downstream of yggT) is mediated by the alternative sigma factor σ32, which governs response to temperature stress . Additionally, under anaerobic conditions, rdgB expression is repressed by FNR (fumarate and nitrate reduction regulatory protein) . These regulatory mechanisms might also influence yggT expression and provide clues about its function under specific stress conditions.

What are the best protocols for detecting and quantifying yggT in cellular samples?

Due to the membrane-associated nature of yggT, specialized approaches are needed for detection and quantification:

  • Western blotting: Using specific antibodies against yggT or epitope tags if using recombinant tagged versions.

  • Mass spectrometry: For precise quantification, selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) approaches can be used.

  • Fluorescence microscopy: Localization studies using fluorescent protein fusions or immunofluorescence with specific antibodies.

  • Flow cytometry: For quantitative analysis of expression levels in population studies.

When designing detection methods, consider:

  • Proper membrane solubilization buffers containing appropriate detergents

  • Controls for specificity validation (knockout strains, competing peptides)

  • Calibration standards for absolute quantification

  • Appropriate cellular fractionation to enrich for membrane proteins

What experimental design approaches are most effective for studying membrane proteins like yggT?

Effective study of membrane proteins requires careful experimental design:

  • Case study approach: In-depth analysis of yggT in a single model organism with comprehensive characterization of its properties and phenotypic effects .

  • Comparative case studies: Comparing yggT function across different bacterial species to identify conserved and divergent properties .

  • Quantitative analysis: Combining multiple experimental approaches (genomics, proteomics, phenotypic assays) to establish relationships between yggT expression/activity and cellular functions .

When designing experiments, consider:

  • Proper controls including empty vector controls, non-functional mutants, and wild-type comparisons

  • Validation of results using complementary methods

  • Use of conditional expression systems to avoid toxicity issues

  • Careful selection of detergents and buffer conditions for biochemical assays

How can researchers address the challenges of reproducing results with membrane proteins like yggT?

Reproducibility challenges with membrane proteins require systematic approaches:

  • Standardized protocols: Detailed documentation of expression conditions, detergent types/concentrations, and buffer compositions.

  • Quality control metrics: Establish clear criteria for protein purity, homogeneity, and activity.

  • Multiple expression constructs: Test various fusion tags, truncations, and expression vectors to identify the most stable and functional form.

  • Independent validation: Use multiple complementary techniques to confirm key findings.

  • Environmental variables control: Carefully monitor and report temperature, pH, ionic strength, and lipid composition in all experiments.

Researchers should consider establishing collaborative networks to independently validate key findings and develop standardized protocols that enhance reproducibility across different laboratories studying yggT and related membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.