Recombinant Uncharacterized protein ygiM (ygiM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ygiM; Z4408; ECs3938; Uncharacterized protein YgiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-206
Protein Length
Full Length of Mature Protein
Species
Escherichia coli O157:H7
Target Names
ygiM
Target Protein Sequence
EETRYVSDELNTWVRSGPGDHYRLVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIPL KQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQ KLKNELIVAQKKVDAASVQLDDKQRTIIMQWFMYGGGVLGLGLLLGLVLPHLIPSRKRKD RWMN
Uniprot No.

Target Background

Database Links

KEGG: ece:Z4408

STRING: 155864.Z4408

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YgiM and what are its basic characteristics?

YgiM is an uncharacterized membrane protein found in several bacterial species including Escherichia coli and Klebsiella pneumoniae. In E. coli, YgiM (UniProt accession P0ADT8) has a molecular weight of approximately 23,062 Da . It is classified as a membrane protein with confirmed structural data available, making it one of the notable membrane proteins identified through large-scale proteomics approaches . The mature protein spans from amino acids 23-206, and recombinant versions typically include a His-tag for purification purposes .

What expression systems are commonly used for recombinant YgiM production?

Recombinant YgiM is primarily expressed in E. coli expression systems. Based on the available data, several recombinant versions exist with varying bacterial origins, including E. coli itself and Shigella flexneri . The expression typically includes the full-length mature protein (residues 23-206) with a His-tag for affinity purification . When designing expression systems for membrane proteins like YgiM, it's crucial to consider factors such as codon optimization, signal peptide selection, and membrane integration efficiency to maximize proper folding and functional expression.

How is YgiM classified within membrane protein categories?

YgiM belongs to the broader category of integral membrane proteins. In large-scale identification studies of membrane proteins with properties favorable for structural studies, YgiM was identified as one of the abundant membrane proteins in E. coli with an emPAI (exponentially modified protein abundance index) value of 7.65 . This relatively high abundance suggests that YgiM may be more amenable to purification and potential structural studies compared to many other membrane proteins. It appears in databases as having structural information available, placing it among the approximately 45% of identified E. coli membrane proteins that have been structurally characterized .

What are the recommended approaches for creating YgiM knockout mutants?

Based on recent research, CRISPR/Cas9-mediated genome editing represents an effective approach for generating YgiM deletion mutants. The methodology involves:

  • Analyzing the wild-type gene sequence using appropriate online tools (e.g., http://crispr.tefor.net/) to identify suitable 20-nt base-pairing regions (N20) for sgRNA design

  • Ensuring the selected N20 sequence is unique in the genome and is followed by an NGG protospacer adjacent motif (PAM)

  • Amplifying the sgRNA fragment with appropriate primers and restriction sites (e.g., SpeI and XbaI)

  • Inserting the PCR product into a suitable plasmid (e.g., pSGKP-rif)

  • Co-transferring the constructed plasmid and homology arms into the target strain containing a Cas9 expression plasmid

  • Confirming successful deletion by both PCR and Sanger sequencing

This approach has been successfully applied in K. pneumoniae, resulting in complete deletion of the YgiM gene while maintaining normal bacterial growth patterns .

What methods are most effective for studying YgiM localization and topology?

For membrane proteins like YgiM, a multi-faceted approach to localization and topology studies is recommended:

  • Fluorescence microscopy: Fusing YgiM with fluorescent proteins (e.g., GFP) to visualize its cellular localization

  • Membrane fractionation: Separating inner and outer membrane fractions to confirm YgiM's localization

  • Protease accessibility assays: Using proteases to cleave exposed regions of the protein, followed by mass spectrometry to determine which regions are protected by the membrane

  • Cysteine scanning mutagenesis: Introducing cysteine residues at various positions in the protein and testing their accessibility to membrane-impermeable sulfhydryl reagents

  • Cryo-electron microscopy: For higher-resolution structural analysis of the protein within the membrane context

These approaches, combined with bioinformatic predictions of transmembrane domains, can provide comprehensive information about YgiM's membrane orientation and topology.

How can researchers effectively complement YgiM deletion mutants?

Based on documented methodologies, complementation of YgiM deletion mutants can be achieved through the following approach:

  • Amplify the ygiM gene from the wild-type bacterial chromosome using PCR with primers containing appropriate restriction sites (e.g., EcoRI and XbaI)

  • Clone the amplified gene into an expression vector (such as pBAD24) that allows controlled expression

  • Transform the recombinant plasmid into E. coli DH5α for amplification

  • Confirm positive colonies using specific primers (e.g., YgiM-F and YgiM-R) on selectable media (e.g., LB agar with 100 μg/ml ampicillin)

  • Transform the verified plasmid into the YgiM deletion mutant strain

  • Confirm expression through functional assays, comparing the complemented strain with both wild-type and deletion mutant strains

The use of an arabinose-inducible promoter in vectors like pBAD24 allows for controlled expression levels, which is important when studying membrane proteins that may be toxic when overexpressed.

What is the current understanding of YgiM's role in bacterial pathogenesis?

Recent research has begun to elucidate YgiM's potential role in bacterial pathogenesis, particularly in Klebsiella pneumoniae. Experimental evidence suggests that YgiM contributes to bacterial resistance against phagocytosis by macrophages. In a comparative study between wild-type and YgiM deletion mutants (ΔygiM), researchers found that more ΔygiM strains were recovered from THP-1-derived macrophages after 24 hours of co-culture, indicating that YgiM enhances bacterial anti-phagocytic abilities .

How does YgiM deletion affect bacterial growth and phenotype?

Current evidence indicates that YgiM deletion does not significantly affect basic bacterial growth characteristics. Growth curve analyses of wild-type K. pneumoniae and ΔygiM strains showed similar patterns over a 24-hour period in LB broth, with comparable OD600 measurements and CFU/ml counts . Additionally, colony morphology on LB agar plates appeared similar between the two strains .

What interactions has YgiM been shown to have with other proteins or cellular components?

To investigate potential interaction partners, researchers should consider:

  • Co-immunoprecipitation (Co-IP) with antibodies against tagged versions of YgiM, followed by mass spectrometry to identify binding partners

  • Bacterial two-hybrid systems adapted for membrane proteins to screen for interacting proteins

  • Proximity-based labeling approaches such as BioID or APEX2 to identify proteins in close proximity to YgiM in the native cellular environment

  • Crosslinking mass spectrometry to capture transient interactions within the membrane environment

These methodologies could help elucidate the protein interaction network of YgiM and provide insights into its functional role in bacterial physiology and pathogenesis.

What structural information is currently available for YgiM?

For membrane proteins, structural information may come from various methods including X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy. Researchers interested in the structural aspects of YgiM should consult structural databases such as the Protein Data Bank (PDB) for the most up-to-date information. The availability of structural data provides opportunities for structure-based functional predictions and potential drug design targeting YgiM.

What purification strategies are most effective for obtaining stable YgiM for structural studies?

While specific purification protocols for YgiM are not detailed in the search results, general approaches for membrane proteins that appear to be amenable to structural studies (like YgiM) can be recommended:

  • Expression optimization: Use of specialty E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Detergent screening: Systematic testing of different detergents (DDM, LMNG, DM, etc.) for efficient extraction while maintaining protein stability

  • Affinity purification: Utilizing the His-tag present in recombinant versions for initial capture via IMAC (Immobilized Metal Affinity Chromatography)

  • Size exclusion chromatography: As a final polishing step to ensure homogeneity and remove aggregates

  • Stability assessment: Thermal shift assays or limited proteolysis to identify optimal buffer conditions

The identification of YgiM in screens for structurally amenable membrane proteins suggests it may be relatively stable compared to many other membrane proteins . Similar to the approach used for Yop1 (another membrane protein identified in the same screen), researchers should monitor the size exclusion chromatography profile to ensure minimal aggregation and homogeneous particle distribution .

What expression systems might improve yields of properly folded YgiM for biophysical studies?

For improved expression of properly folded YgiM, researchers should consider:

  • Specialized E. coli strains: C41(DE3), C43(DE3), or Lemo21(DE3) - engineered specifically for membrane protein expression

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations to slow production and allow proper folding

  • Fusion partners: Addition of folding enhancers like MBP (maltose binding protein) or SUMO at the N-terminus

  • Co-expression of chaperones: GroEL/GroES, DnaK/DnaJ/GrpE to facilitate proper folding

  • Alternative expression hosts: Consider yeast (Pichia pastoris) or insect cell (Sf9, Hi5) systems if bacterial expression is problematic

The identification of YgiM as an abundant membrane protein in E. coli suggests that it is naturally expressed at reasonable levels , indicating that optimization of E. coli-based expression systems is likely to be successful. Careful monitoring of expression through techniques such as in-gel fluorescence or Western blotting is recommended to assess both quantity and quality of the expressed protein.

How might YgiM function be related to antibiotic resistance mechanisms?

While direct evidence linking YgiM to antibiotic resistance mechanisms is not provided in the search results, its role as a membrane protein that contributes to bacterial survival during host interactions suggests potential indirect connections to antimicrobial resistance.

For researchers investigating this possibility, the following approaches are recommended:

  • Comparative susceptibility testing: Determine minimum inhibitory concentrations (MICs) of various antibiotics for wild-type and ΔygiM strains

  • Membrane permeability assays: Assess whether YgiM affects the uptake of dyes or antibiotics that rely on membrane permeation

  • Stress response analysis: Examine whether YgiM contributes to bacterial survival under antibiotic stress conditions

  • Efflux pump activity: Investigate potential interactions between YgiM and known efflux pump components

  • Biofilm formation: Determine if YgiM influences biofilm development, which can contribute to antibiotic tolerance

The finding that YgiM enhances resistance to phagocytosis suggests it may be part of a broader bacterial defense strategy, which could intersect with mechanisms of antibiotic resistance, particularly those involving membrane-associated processes.

What role might YgiM play in bacterial adaptation to environmental stresses?

  • Stress survival assays: Comparing survival of wild-type and ΔygiM strains under various stresses (pH, temperature, oxidative stress, osmotic pressure)

  • Gene expression analysis: Examining whether ygiM expression changes in response to different environmental conditions

  • Membrane integrity tests: Assessing whether YgiM contributes to membrane stability under stress conditions

  • Protein-protein interaction studies: Identifying potential stress-specific interacting partners

  • Comparative genomics: Analyzing the conservation and variation of YgiM across bacterial species from different environmental niches

The experimental framework used to study YgiM's role in phagocytosis resistance could be adapted to investigate responses to environmental stresses, potentially revealing additional functions of this uncharacterized protein.

How can computational approaches be used to predict YgiM function and interaction partners?

Computational approaches offer valuable tools for generating hypotheses about the function of uncharacterized proteins like YgiM:

  • Homology modeling: Using related proteins with known structures to predict YgiM's structure

  • Sequence motif analysis: Identifying functional domains or motifs that might suggest specific functions

  • Molecular dynamics simulations: Exploring YgiM's behavior within the membrane environment

  • Protein-protein interaction prediction: Using algorithms that identify potential binding partners based on sequence, structure, or co-expression data

  • Gene neighborhood analysis: Examining genes located near ygiM across bacterial genomes to identify functionally related genes

These computational predictions should be used to guide experimental design, with in silico findings validated through targeted laboratory experiments. The combination of computational and experimental approaches provides a powerful strategy for uncovering the functions of uncharacterized proteins like YgiM.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.